BQ623191

Overview
NameBQ623191
Unique NameBQ623191
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length520
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig383 contig Csv1_Contig383:27..546. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNJ15_ARATH (Chaperone protein dnaJ 15 OS=Arabidopsis thaliana GN=ATJ15 PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 5.410e-12
Identity = 33/70 (47.14%), Postives = 48/70 (68.57%), Query Frame = 1
Query:  118 AKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            A  +D Y++L V  DA ++EI+S Y +LALK+HPDK  +   A+  F+E+  +Y +LSDP KRR YD+ G
Sbjct:   13 ANRRDPYEVLCVSKDANDQEIKSAYRKLALKYHPDKNANNPDASELFKEVAFSYSILSDPEKRRHYDNAG 82          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_ROSS1 (Chaperone protein dnaJ OS=Roseiflexus sp. (strain RS-1) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 5.410e-12
Identity = 35/71 (49.30%), Postives = 51/71 (71.83%), Query Frame = 1
Query:  115 LAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +A  +DYY++L V  +A+++EI+  + RLA ++HPD  K  D A ++F+EINEAY+VLSDP KR  YD  G
Sbjct:    1 MAVKRDYYEVLGVQRNASQDEIKKAFRRLARQYHPDVNKAPD-AEAKFKEINEAYEVLSDPEKRSMYDRFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_ROSCS (Chaperone protein dnaJ OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 5.410e-12
Identity = 35/71 (49.30%), Postives = 51/71 (71.83%), Query Frame = 1
Query:  115 LAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +A  +DYY++L V  +A+++EI+  + RLA ++HPD  K  D A ++F+EINEAY+VLSDP KR  YD  G
Sbjct:    1 MAVKRDYYEVLGVQRNASQDEIKKAFRRLARQYHPDVNKAPD-AEAKFKEINEAYEVLSDPEKRSMYDRFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_METAC (Chaperone protein dnaJ OS=Methanosarcina acetivorans GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 5.410e-12
Identity = 35/71 (49.30%), Postives = 50/71 (70.42%), Query Frame = 1
Query:  115 LAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +A  +DYY+IL +  DA+ E+I+  Y +LAL++HPD+ KD   A  +F+EI+EAY VLSD  KR +YD  G
Sbjct:    1 MATKRDYYEILGLPKDASVEDIKKTYRKLALQYHPDRNKDPG-AEDKFKEISEAYAVLSDTEKRAQYDRFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ1_STRCO (Chaperone protein dnaJ 1 OS=Streptomyces coelicolor GN=dnaJ1 PE=3 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 5.410e-12
Identity = 35/64 (54.69%), Postives = 43/64 (67.19%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYD 318
            KDYYK+L V  DATE EI+  Y +LA + HPD  K    A  RF+EI+EA  +L DP KR+EYD
Sbjct:    9 KDYYKVLGVPKDATEAEIKKAYRKLARENHPDANKGNVKAEERFKEISEANDILGDPKKRKEYD 72          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: TID_DROME (Protein tumorous imaginal discs, mitochondrial OS=Drosophila melanogaster GN=l(2)tid PE=1 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 7.066e-12
Identity = 34/67 (50.75%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            KDYY  L V  +A  ++I+  Y +LA K+HPD  K+   A  +FQE++EAY+VLSD  KRREYD+ G
Sbjct:   64 KDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREYDTYG 130          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNJB6_XENTR (DnaJ homolog subfamily B member 6 OS=Xenopus tropicalis GN=dnajb6 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.066e-12
Identity = 35/67 (52.24%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  130 DYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKD-RDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +YY +L V  +A+ E+I+  Y +LALKWHPDK  D +D A  RF+E+ EAY+VLSD  KR  YD  G
Sbjct:    3 EYYDVLGVQRNASPEDIKKAYRKLALKWHPDKNPDNKDEAERRFKEVAEAYEVLSDSKKRDIYDKYG 69          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_WOLTR (Chaperone protein dnaJ OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.066e-12
Identity = 34/67 (50.75%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            KDYYK+L VD +A+ +EI+  Y +LALK+HPD+      A  +F+EI  AY+VLSD  KR  YD  G
Sbjct:    4 KDYYKLLGVDRNASTDEIKKAYKKLALKYHPDRNPGNKEAEEKFKEITAAYEVLSDSEKRAGYDRYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_WOLSU (Chaperone protein dnaJ OS=Wolinella succinogenes GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.066e-12
Identity = 32/66 (48.48%), Postives = 46/66 (69.70%), Query Frame = 1
Query:  130 DYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            DYY+ILE++  A+ EEI+  Y ++A+K+HPD+ +    A   F+ +NEAYQVLSD  KR+ YD  G
Sbjct:    5 DYYEILEIERSASGEEIKKAYRKMAMKYHPDRNEGSSEAEEMFKRVNEAYQVLSDEGKRQLYDRYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_RALME (Chaperone protein dnaJ OS=Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.066e-12
Identity = 30/67 (44.78%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L V  +A+++EI+  Y +LA+K HPD+  D   A  +F+E+ EAY++LSDP K+  YD  G
Sbjct:    4 RDYYEVLGVGKNASDDEIKKAYRKLAMKHHPDRNPDNKEAEEKFKEVKEAYEMLSDPEKKAAYDQYG 70          
The following BLAST results are available for this feature:
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 356
Match NameE-valueIdentityDescription
DNJ15_ARATH5.410e-1247.14Chaperone protein dnaJ 15 OS=Arabidopsis thaliana ... [more]
DNAJ_ROSS15.410e-1249.30Chaperone protein dnaJ OS=Roseiflexus sp. (strain ... [more]
DNAJ_ROSCS5.410e-1249.30Chaperone protein dnaJ OS=Roseiflexus castenholzii... [more]
DNAJ_METAC5.410e-1249.30Chaperone protein dnaJ OS=Methanosarcina acetivora... [more]
DNAJ1_STRCO5.410e-1254.69Chaperone protein dnaJ 1 OS=Streptomyces coelicolo... [more]
TID_DROME7.066e-1250.75Protein tumorous imaginal discs, mitochondrial OS=... [more]
DNJB6_XENTR7.066e-1252.24DnaJ homolog subfamily B member 6 OS=Xenopus tropi... [more]
DNAJ_WOLTR7.066e-1250.75Chaperone protein dnaJ OS=Wolbachia sp. subsp. Bru... [more]
DNAJ_WOLSU7.066e-1248.48Chaperone protein dnaJ OS=Wolinella succinogenes G... [more]
DNAJ_RALME7.066e-1244.78Chaperone protein dnaJ OS=Ralstonia metallidurans ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00282 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00282 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623191 ID=BQ623191|Name=BQ623191|organism=Citrus sinensis|type=EST|length=520bp
GTTTGTGTCCCCTCTACTAAAGAGGTCATGATGTGGGACGAATGGGTCGA
TTGCAACAATAACGATGAACAAACCCAACAGGATTCCCATGTCAATTTTG
ATTTTCTTTCTCTTCTCGCCAAACCCAAGGATTATTATAAAATATTGGAA
GTTGATTACGATGCCACGGAGGAAGAAATTAGGTCCAATTACATTCGTCT
AGCGCTGAAATGGCACCCAGATAAGCAAAAGGATCGAGATTGTGCAACTT
CGAGATTTCAAGAGATAAACGAGGCTTACCAGGTTTTGAGCGATCCTGTC
AAAAGGAGAGAATATGACAGCAAAGGGATGTTGCACATATATGATCGCAA
CATAATTGAGTATCTTAATCGCTACAAGGGCTTAATATTAACTTGCAATG
GTCTTGGGATGAGGCATTCAATTGTGTAATATGTTGTCAGCACAGTTGGG
GCAGTTCATATTGGGAGGCATAGAATTACCAATGCTGCAAATAGCATTGA
GGGCATGGAGAATAGCAGTT
back to top