BQ623209

Overview
NameBQ623209
Unique NameBQ623209
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length557
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2750 contig Csv1_Contig2750:50..605. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: EIF1B_MOUSE (Eukaryotic translation initiation factor 1b OS=Mus musculus GN=Eif1b PE=2 SV=2)

HSP 1 Score: 126.716 bits (317), Expect = 7.424e-29
Identity = 54/89 (60.67%), Postives = 75/89 (84.27%), Query Frame = 2
Query:  191 AGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            AG+++Y+HIR+QQRNGRK+LTTVQG+  ++   K++K  KK+F CNGTV++ PE G+VIQLQGDQRKN+  FL++ GIVK+E +K+HGF
Sbjct:   25 AGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF 113          
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: EIF1B_MACFA (Eukaryotic translation initiation factor 1b OS=Macaca fascicularis GN=EIF1B PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 7.424e-29
Identity = 54/89 (60.67%), Postives = 75/89 (84.27%), Query Frame = 2
Query:  191 AGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            AG+++Y+HIR+QQRNGRK+LTTVQG+  ++   K++K  KK+F CNGTV++ PE G+VIQLQGDQRKN+  FL++ GIVK+E +K+HGF
Sbjct:   25 AGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF 113          
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: EIF1B_HUMAN (Eukaryotic translation initiation factor 1b OS=Homo sapiens GN=EIF1B PE=1 SV=2)

HSP 1 Score: 126.716 bits (317), Expect = 7.424e-29
Identity = 54/89 (60.67%), Postives = 75/89 (84.27%), Query Frame = 2
Query:  191 AGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            AG+++Y+HIR+QQRNGRK+LTTVQG+  ++   K++K  KK+F CNGTV++ PE G+VIQLQGDQRKN+  FL++ GIVK+E +K+HGF
Sbjct:   25 AGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF 113          
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: EIF1_PONAB (Eukaryotic translation initiation factor 1 OS=Pongo abelii GN=EIF1 PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.208e-28
Identity = 52/89 (58.43%), Postives = 73/89 (82.02%), Query Frame = 2
Query:  191 AGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            AG+++Y+HIR+QQRNGRK+LTTVQG+  ++   K++K  KK+F CNGTV++ PE G+VIQLQGDQRKN+  FLV+ G+ K + +K+HGF
Sbjct:   25 AGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF 113          
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: EIF1_HUMAN (Eukaryotic translation initiation factor 1 OS=Homo sapiens GN=EIF1 PE=1 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.208e-28
Identity = 52/89 (58.43%), Postives = 73/89 (82.02%), Query Frame = 2
Query:  191 AGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            AG+++Y+HIR+QQRNGRK+LTTVQG+  ++   K++K  KK+F CNGTV++ PE G+VIQLQGDQRKN+  FLV+ G+ K + +K+HGF
Sbjct:   25 AGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF 113          
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: EIF1_BOVIN (Eukaryotic translation initiation factor 1 OS=Bos taurus GN=EIF1 PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.208e-28
Identity = 52/89 (58.43%), Postives = 73/89 (82.02%), Query Frame = 2
Query:  191 AGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            AG+++Y+HIR+QQRNGRK+LTTVQG+  ++   K++K  KK+F CNGTV++ PE G+VIQLQGDQRKN+  FLV+ G+ K + +K+HGF
Sbjct:   25 AGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF 113          
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: EIF1_MOUSE (Eukaryotic translation initiation factor 1 OS=Mus musculus GN=Eif1 PE=2 SV=2)

HSP 1 Score: 122.865 bits (307), Expect = 1.072e-27
Identity = 51/89 (57.30%), Postives = 73/89 (82.02%), Query Frame = 2
Query:  191 AGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            AG+++Y+HIR+QQRNGRK+LTTVQG+  ++   K++K  KK+F CNGTV++ PE G+VIQLQGDQRKN+  FL++ G+ K + +K+HGF
Sbjct:   25 AGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLIEIGLAKDDQLKVHGF 113          
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: SUI1_YEAST (Eukaryotic translation initiation factor eIF-1 OS=Saccharomyces cerevisiae GN=SUI1 PE=1 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 2.919e-25
Identity = 50/92 (54.35%), Postives = 71/92 (77.17%), Query Frame = 2
Query:  182 DSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            D    +  Y+HIR+QQRNGRK+LTTVQG+ +E+   +ILK LKK+F CNG +V+DPE+G++IQLQGDQR  V  F++    ++K++IK+HGF
Sbjct:   17 DDETATSNYIHIRIQQRNGRKTLTTVQGVPEEYDLKRILKVLKKDFACNGNIVKDPEMGEIIQLQGDQRAKVCEFMISQLGLQKKNIKIHGF 108          
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: SUI1_ANOGA (Protein translation factor SUI1 homolog OS=Anopheles gambiae GN=AGAP006459 PE=3 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 2.919e-25
Identity = 50/83 (60.24%), Postives = 67/83 (80.72%), Query Frame = 2
Query:  209 VHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            VHIR+QQRNGRK+LTTVQGL  E+   KI++  KKEF CNGTV++ PE G+V+QLQGDQR+N+  +L ++G+ K E +K+HGF
Sbjct:   28 VHIRIQQRNGRKTLTTVQGLSAEYDLKKIVRACKKEFACNGTVIEHPEYGEVLQLQGDQRENICQWLTKSGLAKPEQLKVHGF 110          
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: SUI1_DROME (Protein translation factor SUI1 homolog OS=Drosophila melanogaster GN=CG17737 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 4.980e-25
Identity = 49/83 (59.04%), Postives = 66/83 (79.52%), Query Frame = 2
Query:  209 VHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            VHIR+QQRNGRK+LTTVQGL  E+   KI++  KKEF CNGTV++ PE G+V+QLQGDQR+N+  +L + G+ K + +K+HGF
Sbjct:   28 VHIRIQQRNGRKTLTTVQGLSAEYDLKKIVRSCKKEFACNGTVIEHPEYGEVLQLQGDQRENICQWLTKVGLAKPDQLKVHGF 110          
The following BLAST results are available for this feature:
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 23
Match NameE-valueIdentityDescription
EIF1B_MOUSE7.424e-2960.67Eukaryotic translation initiation factor 1b OS=Mus... [more]
EIF1B_MACFA7.424e-2960.67Eukaryotic translation initiation factor 1b OS=Mac... [more]
EIF1B_HUMAN7.424e-2960.67Eukaryotic translation initiation factor 1b OS=Hom... [more]
EIF1_PONAB8.208e-2858.43Eukaryotic translation initiation factor 1 OS=Pong... [more]
EIF1_HUMAN8.208e-2858.43Eukaryotic translation initiation factor 1 OS=Homo... [more]
EIF1_BOVIN8.208e-2858.43Eukaryotic translation initiation factor 1 OS=Bos ... [more]
EIF1_MOUSE1.072e-2757.30Eukaryotic translation initiation factor 1 OS=Mus ... [more]
SUI1_YEAST2.919e-2554.35Eukaryotic translation initiation factor eIF-1 OS=... [more]
SUI1_ANOGA2.919e-2560.24Protein translation factor SUI1 homolog OS=Anophel... [more]
SUI1_DROME4.980e-2559.04Protein translation factor SUI1 homolog OS=Drosoph... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00300 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00300 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623209 ID=BQ623209|Name=BQ623209|organism=Citrus sinensis|type=EST|length=557bp
TCCGATTTAGGGTTTCTTTTTGATCTTATCAGATCGGACTATCTCGATTA
TTAAACCCTAATCTTCGGATCAGGTCTGAGCATTCCGGTTGTTGGGCCCC
TTGCATCAGCTGAGGTTCATGTCTGATTTTGATATCCAGGTTCCTGCTGC
CTTTGACCCGTTTGCTGATGCAAAGGCTGAGGACTCAGGTGCTGGTTCAA
AAGAGTATGTGCATATCCGTGTTCAGCAACGGAATGGTAGGAAAAGCCTG
ACAACTGTCCAGGGGTTGAAGAAAGAATTTAGTTACAACAAAATCCTCAA
GGACCTCAAAAAGGAATTTTGCTGCAATGGAACAGTGGTCCAGGATCCTG
AACTAGGACAGGTCATTCAACTCCAAGGTGACCAGCGGAAGAATGTATCT
ACGTTCCTTGTTCAGGCTGGGATTGTGAAGAAGGAACATATCAAAATGCA
TGGCTTTTAAGTAAACAGCAACTTCCGTTTCTGCACATTTGGTGACCCGC
GTTCGTCAGTGCAGTGCAGAACATGCTATTGATACTATTAAAAAAAAAAA
AAAAAAA
back to top