BQ623353

Overview
NameBQ623353
Unique NameBQ623353
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length562
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9230 contig Csv1_Contig9230:445..1005. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB12_PETHY (Chlorophyll a-b binding protein, chloroplastic OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.142e-16
Identity = 57/165 (34.55%), Postives = 76/165 (46.06%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGVIPPAGTYNYWADPYTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLG----------------GSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADP 448
            G   PE L K G++      +W+       AG   Y+ D  TLFV+E+ L+G+AE RR+ D   PG +         K  G                GSG PA                  +K+ + KE+KNGRLAMLA++G + Q + TG GP  NL  HLADP
Sbjct:  120 GIFIPEFLTKIGVL---NTPSWYT------AGEQEYFTDTTTLFVIELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPA-----------------KIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADP 258          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB22_ARATH (Chlorophyll a-b binding protein 2, chloroplastic OS=Arabidopsis thaliana GN=CAB2A PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.543e-16
Identity = 60/162 (37.04%), Postives = 82/162 (50.62%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R    A  G +G    L    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  112 GCVFPELLARNGVKFGEAV--WFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRV---AGNGPLGEAEDL---LYPGGSFDPL----------GLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNN 255          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB21_ARATH (Chlorophyll a-b binding protein 165/180, chloroplastic OS=Arabidopsis thaliana GN=LHCP-A PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.543e-16
Identity = 60/162 (37.04%), Postives = 82/162 (50.62%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R    A  G +G    L    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  112 GCVFPELLARNGVKFGEAV--WFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRV---AGNGPLGEAEDL---LYPGGSFDPL----------GLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNN 255          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB2B_PINSY (Chlorophyll a-b binding protein type 2 member 1B, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 3.322e-16
Identity = 58/162 (35.80%), Postives = 82/162 (50.62%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP              +D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  120 GCVFPELLARNGVKFGEAV--WFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAG----GPLGE---VTDPIYPGGSFDPL----------GLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNN 262          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB21_GOSHI (Chlorophyll a-b binding protein 151, chloroplastic OS=Gossypium hirsutum GN=CAB-151 PE=2 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 3.322e-16
Identity = 60/163 (36.81%), Postives = 81/163 (49.69%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEK-YLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PEIL K G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMGF E  R       G +G     G +  Y GG+ DP               D  +  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPV NN
Sbjct:  111 GCVFPEILSKNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYR----VGGGPLGE----GLDPIYPGGAFDPL----------GLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN 253          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB2B_SOLLC (Chlorophyll a-b binding protein 1B, chloroplastic OS=Solanum lycopersicum GN=CAB1B PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 4.338e-16
Identity = 58/162 (35.80%), Postives = 82/162 (50.62%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP              +D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  111 GCVFPELLARNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAG----GPLGE---VVDPLYPGGSFDPL----------GLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 253          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB22_ORYSJ (Chlorophyll a-b binding protein 2, chloroplastic OS=Oryza sativa subsp. japonica GN=CAB2R PE=2 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 4.338e-16
Identity = 58/162 (35.80%), Postives = 82/162 (50.62%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++ +++ LMG  E  R       G +G    +    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  107 GCVFPELLARNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAG----GPLGE---VVDPLYPGGSFDPL----------GLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 249          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB24_TOBAC (Chlorophyll a-b binding protein 40, chloroplastic OS=Nicotiana tabacum GN=CAB40 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 5.666e-16
Identity = 58/162 (35.80%), Postives = 82/162 (50.62%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP              +D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  113 GCVFPELLARNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAG----GPLGE---VVDPLYPGGSFDPL----------GLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 255          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB24_SOLLC (Chlorophyll a-b binding protein 4, chloroplastic OS=Solanum lycopersicum GN=CAB4 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 5.666e-16
Identity = 59/163 (36.20%), Postives = 82/163 (50.31%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEK-YLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PEIL K G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMGF E  R       G +G     G +K Y GG+ DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DH+ DPV NN
Sbjct:  111 GCVFPEILSKNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYR----VGGGPLGE----GLDKIYPGGAFDPL----------GLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHINDPVANN 253          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB21_TOBAC (Chlorophyll a-b binding protein 16, chloroplastic OS=Nicotiana tabacum GN=CAB16 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 5.666e-16
Identity = 58/162 (35.80%), Postives = 82/162 (50.62%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP              +D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  112 GCVFPELLARNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAG----GPLGE---VVDPLYPGGSFDPL----------GLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 254          
The following BLAST results are available for this feature:
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
CB12_PETHY1.142e-1634.55Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB22_ARATH2.543e-1637.04Chlorophyll a-b binding protein 2, chloroplastic O... [more]
CB21_ARATH2.543e-1637.04Chlorophyll a-b binding protein 165/180, chloropla... [more]
CB2B_PINSY3.322e-1635.80Chlorophyll a-b binding protein type 2 member 1B, ... [more]
CB21_GOSHI3.322e-1636.81Chlorophyll a-b binding protein 151, chloroplastic... [more]
CB2B_SOLLC4.338e-1635.80Chlorophyll a-b binding protein 1B, chloroplastic ... [more]
CB22_ORYSJ4.338e-1635.80Chlorophyll a-b binding protein 2, chloroplastic O... [more]
CB24_TOBAC5.666e-1635.80Chlorophyll a-b binding protein 40, chloroplastic ... [more]
CB24_SOLLC5.666e-1636.20Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB21_TOBAC5.666e-1635.80Chlorophyll a-b binding protein 16, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00444 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00444 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623353 ID=BQ623353|Name=BQ623353|organism=Citrus sinensis|type=EST|length=562bp
GGGAGCCATTGCACCGGAGATTCTTGGCAAGGCAGGCCTCATTCCGCAAG
AAACTGCCCTGGCCTGGTTCCAAACCGGTGTGATCCCCCCAGCGGGAACA
TACAACTACTGGGCAGACCCTTACACACTTTTCGTCCTGGAAATGGCACT
CATGGGATTTGCCGAGCACCGGAGATTCCAAGACTGGGCAAATCCAGGAT
CAATGGGCAGGCAATACTTCCTCGGATTCGAGAAATACTTGGGAGGATCC
GGCGATCCGGCTTACCCTGGAGGACCTCTATTCAACCCTCTGGGTCTTGG
GAAAGATGAGAAGTCAATGAAGGATTTCAAGCTCAAGGAAGTGAAGAATG
GAAGATTGGCAATGTTGGCAATCTTGGGTTACTTTGTTCAAGGTCTTGTT
ACAGGAGTTGGGCCTTACCAGAACCTATTGGATCACTTGGCTGATCCTGT
AAACAACAATGTTTTGACTAGCCTATAGTTTCACTGAGAGAGAAATTTCT
TGTTCATTGCTTTGGAATTATATATTCCAAGCCTTGTCATCCCCCACTCT
GTTCTATTCTAC
back to top