BQ623353

Overview
NameBQ623353
Unique NameBQ623353
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length562
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9230 contig Csv1_Contig9230:445..1005. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB21_ORYSJ (Chlorophyll a-b binding protein 1, chloroplastic OS=Oryza sativa subsp. japonica GN=CAB1R PE=2 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 9.664e-16
Identity = 57/162 (35.19%), Postives = 82/162 (50.62%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++ +++ LMG  E  R       G +G    +    Y GG+ DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  111 GCVFPELLARNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAG----GPLGE---VVDPLYPGGAFDPL----------GLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 253          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB22_CUCSA (Chlorophyll a-b binding protein of LHCII type 1 (Fragment) OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.262e-15
Identity = 58/162 (35.80%), Postives = 81/162 (50.00%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:   52 GCVFPELLSRNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAG----GPLGE---VTDPIYPGGSFDPL----------GLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 194          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB21_LEMGI (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Lemna gibba PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.262e-15
Identity = 58/163 (35.58%), Postives = 81/163 (49.69%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEK-YLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G I PE+L K G+  Q     WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G     G +  Y GG+ DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DH+ADPV NN
Sbjct:  110 GCIFPELLSKNGV--QFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVVLMGLIEGYR----VGGGPLGE----GLDPLYPGGAFDPL----------GLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHIADPVANN 252          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB21_CUCSA (Chlorophyll a-b binding protein of LHCII type I, chloroplastic (Fragment) OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.262e-15
Identity = 58/162 (35.80%), Postives = 81/162 (50.00%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  101 GCVFPELLSRNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAG----GPLGE---VTDPIYPGGSFDPL----------GLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 243          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB23_APIGR (Chlorophyll a-b binding protein, chloroplastic OS=Apium graveolens GN=LHC0 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.649e-15
Identity = 58/162 (35.80%), Postives = 82/162 (50.62%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P         +++  ++ LMG  E  R       G +G    +    Y GGS DP              +D +   + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  110 GCVFPELLARNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLVHAQSILSIWATQVILMGAVEGYRVAG----GPLGE---IVDPLYPGGSFDPL----------GLAEDPERSAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 252          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB22_PEA (Chlorophyll a-b binding protein AB80, chloroplastic OS=Pisum sativum GN=AB80 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.649e-15
Identity = 58/162 (35.80%), Postives = 81/162 (50.00%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  115 GCVFPELLSRNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAG----GPLGE---VVDPLYPGGSFDPL----------GLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 257          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB22_HORVU (Chlorophyll a-b binding protein 2, chloroplastic OS=Hordeum vulgare GN=CAB2 PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.649e-15
Identity = 58/162 (35.80%), Postives = 80/162 (49.38%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G   Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  110 GCVFPELLARNGVKFGEAV--WFKKGSQIFSEGGLQYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAG----GPLGE---VVDPLYPGGSFDPL----------GLADDAEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 252          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB2_PHYPA (Chlorophyll a-b binding protein, chloroplastic OS=Physcomitrella patens PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.153e-15
Identity = 58/162 (35.80%), Postives = 80/162 (49.38%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L K+G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP               D  +  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPV NN
Sbjct:  114 GCLTPELLAKSGVKFGEAV--WFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAG----GPLGE---VTDPIYPGGSFDPL----------GLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLNDHLADPVANN 256          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB2A_PYRPY (Chlorophyll a-b binding protein 1A, chloroplastic OS=Pyrus pyrifolia PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.153e-15
Identity = 58/162 (35.80%), Postives = 79/162 (48.77%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADPY--------TLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y   P          ++  ++ LMG  E  R       G +G    +    Y GG+ DP               D  +  D K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  124 GCVFPELLARNGVKFGEAV--WFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAG----GPLGE---VTDPIYPGGNFDPL----------GLADDPDAFADVKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNN 266          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB29_MAIZE (Chlorophyll a-b binding protein M9, chloroplastic OS=Zea mays GN=CAB-M9 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.153e-15
Identity = 58/162 (35.80%), Postives = 81/162 (50.00%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GG+ DP               D ++  D K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  111 GCVFPELLARNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAIEGYRVAG----GPLGE---VVDPLYPGGTFDPL----------GLADDPEAFADVKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 253          
The following BLAST results are available for this feature:
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
CB21_ORYSJ9.664e-1635.19Chlorophyll a-b binding protein 1, chloroplastic O... [more]
CB22_CUCSA1.262e-1535.80Chlorophyll a-b binding protein of LHCII type 1 (F... [more]
CB21_LEMGI1.262e-1535.58Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB21_CUCSA1.262e-1535.80Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB23_APIGR1.649e-1535.80Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB22_PEA1.649e-1535.80Chlorophyll a-b binding protein AB80, chloroplasti... [more]
CB22_HORVU1.649e-1535.80Chlorophyll a-b binding protein 2, chloroplastic O... [more]
CB2_PHYPA2.153e-1535.80Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB2A_PYRPY2.153e-1535.80Chlorophyll a-b binding protein 1A, chloroplastic ... [more]
CB29_MAIZE2.153e-1535.80Chlorophyll a-b binding protein M9, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00444 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00444 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623353 ID=BQ623353|Name=BQ623353|organism=Citrus sinensis|type=EST|length=562bp
GGGAGCCATTGCACCGGAGATTCTTGGCAAGGCAGGCCTCATTCCGCAAG
AAACTGCCCTGGCCTGGTTCCAAACCGGTGTGATCCCCCCAGCGGGAACA
TACAACTACTGGGCAGACCCTTACACACTTTTCGTCCTGGAAATGGCACT
CATGGGATTTGCCGAGCACCGGAGATTCCAAGACTGGGCAAATCCAGGAT
CAATGGGCAGGCAATACTTCCTCGGATTCGAGAAATACTTGGGAGGATCC
GGCGATCCGGCTTACCCTGGAGGACCTCTATTCAACCCTCTGGGTCTTGG
GAAAGATGAGAAGTCAATGAAGGATTTCAAGCTCAAGGAAGTGAAGAATG
GAAGATTGGCAATGTTGGCAATCTTGGGTTACTTTGTTCAAGGTCTTGTT
ACAGGAGTTGGGCCTTACCAGAACCTATTGGATCACTTGGCTGATCCTGT
AAACAACAATGTTTTGACTAGCCTATAGTTTCACTGAGAGAGAAATTTCT
TGTTCATTGCTTTGGAATTATATATTCCAAGCCTTGTCATCCCCCACTCT
GTTCTATTCTAC
back to top