BQ623353

Overview
NameBQ623353
Unique NameBQ623353
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length562
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9230 contig Csv1_Contig9230:445..1005. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB23_SOYBN (Chlorophyll a-b binding protein 3, chloroplastic OS=Glycine max GN=CAB3 PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.069e-14
Identity = 57/162 (35.19%), Postives = 80/162 (49.38%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLA PVNNN
Sbjct:  109 GCVFPELLSRNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAG----GPLGE---VTDPIYPGGSFDPL----------GLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLAGPVNNN 251          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB21_PETSP (Chlorophyll a-b binding protein 13, chloroplastic OS=Petunia sp. GN=CAB13 PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.069e-14
Identity = 56/162 (34.57%), Postives = 79/162 (48.77%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+  + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G         Y GGS DP               D ++  + ++KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  112 GCVFPELFARNGVKFGEAV--WFKAGSQIFKEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAG----GPLGEVID---PLYPGGSFDPL----------GLADDPEAFAELEVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 254          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB2_DUNTE (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella tertiolecta PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.396e-14
Identity = 63/167 (37.72%), Postives = 80/167 (47.90%), Query Frame = 2
Query:    2 GAIAPEILGK-AGLIPQETALAWFQTGV-IPPAGTYNYWADPYTL--------FVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNNVLTS 472
            G + PE+L + AG+  Q     WF+ G  I   G  NY  +   +          +++ LMG AE  R    AN GS G    L    Y GG  DP               D  +  + K+KE+KNGRLAM + LG+FVQ +VTG GP QNL DHLADP  N    S
Sbjct:   96 GILTPELLSQYAGV--QFGEPVWFKAGAQIFADGGLNYLGNESLIHAQSIIATLAVQVVLMGLAEAYR----ANGGSEGFLDDLD-TLYPGGPFDPL----------GLADDPDTFAELKVKEIKNGRLAMFSCLGFFVQAIVTGKGPVQNLTDHLADPTVNKAFAS 245          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB21_SOYBN (Chlorophyll a-b binding protein, chloroplastic (Fragment) OS=Glycine max PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.823e-14
Identity = 56/162 (34.57%), Postives = 81/162 (50.00%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E +  WF+ G  I   G  +Y  +           ++  ++ LMG  E  R       G +G    +    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLA+PVNNN
Sbjct:   91 GCVFPELLARNGVKFGEAS--WFKAGSQIFSEGGLDYLGNQSLIHAQSILAIWATQVILMGAVEGYRIAG----GPLGE---VTDPIYPGGSFDPL----------ALADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLAEPVNNN 233          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB21_RAPSA (Chlorophyll a-b binding of LHCII type 1 protein (Fragment) OS=Raphanus sativus PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.823e-14
Identity = 47/111 (42.34%), Postives = 62/111 (55.86%), Query Frame = 2
Query:  128 LFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            ++  ++ LMG  E  R    A  G +G    L    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:   18 IWATQVILMGAVEGYRV---AGDGPLGEAEDL---LYPGGSFDPL----------ASLTDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 112          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB48_MAIZE (Chlorophyll a-b binding protein 48, chloroplastic OS=Zea mays GN=CAB48 PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.380e-14
Identity = 56/162 (34.57%), Postives = 78/162 (48.15%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  ++  +P          ++  ++ LMG  E             GR   +    YLGGS DP               D +   + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHL DPVNNN
Sbjct:  110 GCVFPELLARNGVKFGEGV--WFKAGSQIFSEGGLSHPGNPSLVHAQSILAIWACQVVLMGAVEGYHVAG-------GRLGEVVDPLYLGGSFDPL----------GLGDDPERFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLTDPVNNN 252          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB23_POLMU (Chlorophyll a-b binding protein type 1 member F3, chloroplastic OS=Polystichum munitum GN=CABF3 PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.380e-14
Identity = 57/162 (35.19%), Postives = 79/162 (48.77%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L K G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADP  NN
Sbjct:  111 GCVTPELLAKNGVKFGEAV--WFKAGSQIFAEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAG----GPLGE---VEDPIYPGGSFDPL----------GLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHLADPAVNN 253          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB21_WHEAT (Chlorophyll a-b binding protein, chloroplastic OS=Triticum aestivum GN=WHAB1.6 PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.380e-14
Identity = 55/162 (33.95%), Postives = 81/162 (50.00%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP              +  ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP ++L DH+ADPVNNN
Sbjct:  112 GCVFPELLARNGVKFGEAG--WFKAGSQIFSDGGLDYLGNPSLVHAQSLLAIWACQVVLMGAVEGYRIAG----GPLGE---IVDPLYPGGSFDPL----------GLAERPQAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLEDLADHIADPVNNN 254          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB2D_SOLLC (Chlorophyll a-b binding protein 1D (Fragment) OS=Solanum lycopersicum GN=CAB1D PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 5.303e-14
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = 2
Query:  236 YLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            Y GGS DP              +D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:   40 YPGGSFDPL----------GLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 104          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB2C_SOLLC (Chlorophyll a-b binding protein 1C, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB1C PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 5.303e-14
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = 2
Query:  236 YLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            Y GGS DP              +D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  189 YPGGSFDPL----------GLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 253          
The following BLAST results are available for this feature:
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
CB23_SOYBN1.069e-1435.19Chlorophyll a-b binding protein 3, chloroplastic O... [more]
CB21_PETSP1.069e-1434.57Chlorophyll a-b binding protein 13, chloroplastic ... [more]
CB2_DUNTE1.396e-1437.72Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB21_SOYBN1.823e-1434.57Chlorophyll a-b binding protein, chloroplastic (Fr... [more]
CB21_RAPSA1.823e-1442.34Chlorophyll a-b binding of LHCII type 1 protein (F... [more]
CB48_MAIZE2.380e-1434.57Chlorophyll a-b binding protein 48, chloroplastic ... [more]
CB23_POLMU2.380e-1435.19Chlorophyll a-b binding protein type 1 member F3, ... [more]
CB21_WHEAT2.380e-1433.95Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB2D_SOLLC5.303e-1450.67Chlorophyll a-b binding protein 1D (Fragment) OS=S... [more]
CB2C_SOLLC5.303e-1450.67Chlorophyll a-b binding protein 1C, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00444 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00444 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623353 ID=BQ623353|Name=BQ623353|organism=Citrus sinensis|type=EST|length=562bp
GGGAGCCATTGCACCGGAGATTCTTGGCAAGGCAGGCCTCATTCCGCAAG
AAACTGCCCTGGCCTGGTTCCAAACCGGTGTGATCCCCCCAGCGGGAACA
TACAACTACTGGGCAGACCCTTACACACTTTTCGTCCTGGAAATGGCACT
CATGGGATTTGCCGAGCACCGGAGATTCCAAGACTGGGCAAATCCAGGAT
CAATGGGCAGGCAATACTTCCTCGGATTCGAGAAATACTTGGGAGGATCC
GGCGATCCGGCTTACCCTGGAGGACCTCTATTCAACCCTCTGGGTCTTGG
GAAAGATGAGAAGTCAATGAAGGATTTCAAGCTCAAGGAAGTGAAGAATG
GAAGATTGGCAATGTTGGCAATCTTGGGTTACTTTGTTCAAGGTCTTGTT
ACAGGAGTTGGGCCTTACCAGAACCTATTGGATCACTTGGCTGATCCTGT
AAACAACAATGTTTTGACTAGCCTATAGTTTCACTGAGAGAGAAATTTCT
TGTTCATTGCTTTGGAATTATATATTCCAAGCCTTGTCATCCCCCACTCT
GTTCTATTCTAC
back to top