BQ623353

Overview
NameBQ623353
Unique NameBQ623353
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length562
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9230 contig Csv1_Contig9230:445..1005. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB2A_SOLLC (Chlorophyll a-b binding protein 1A, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB1A PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 5.303e-14
Identity = 38/75 (50.67%), Postives = 49/75 (65.33%), Query Frame = 2
Query:  236 YLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            Y GGS DP              +D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  189 YPGGSFDPL----------GLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 253          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB21_PEA (Chlorophyll a-b binding protein AB96 (Fragment) OS=Pisum sativum GN=AB96 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 5.303e-14
Identity = 56/162 (34.57%), Postives = 80/162 (49.38%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP              +  ++  + K+KE+KNGRLAM ++ G+FV  +VTG GP +NL DHLADPVNNN
Sbjct:   74 GCVFPELLSRNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAG----GPLGE---VVDPLYPGGSFDPL----------GLAEVPEAFAELKVKELKNGRLAMFSMFGFFVPAIVTGKGPLENLADHLADPVNNN 216          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB2F_SOLLC (Chlorophyll a-b binding protein 3B, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB3B PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 9.046e-14
Identity = 37/75 (49.33%), Postives = 49/75 (65.33%), Query Frame = 2
Query:  236 YLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            Y GGS DP              +D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DH+ADPVNNN
Sbjct:  191 YPGGSFDPL----------GLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNN 255          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB2E_SOLLC (Chlorophyll a-b binding protein 3A, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB3A PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 9.046e-14
Identity = 37/75 (49.33%), Postives = 49/75 (65.33%), Query Frame = 2
Query:  236 YLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            Y GGS DP              +D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DH+ADPVNNN
Sbjct:  191 YPGGSFDPL----------GLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNN 255          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB22_PETSP (Chlorophyll a-b binding protein 22L, chloroplastic OS=Petunia sp. GN=CAB22L PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.181e-13
Identity = 54/162 (33.33%), Postives = 78/162 (48.15%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+  + G+   E    W + G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G    +    Y GGS DP              +D ++  + K+KE KNGRLAM ++ G+F+Q +VTG GP +NL DHL DPVNNN
Sbjct:  113 GCVFPELFARNGVKFGEAV--WLKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVLLMGAVEGYRVAG----GPLG---VVVDPLYPGGSFDPL----------GLAEDPEAFAELKVKETKNGRLAMFSMFGFFIQAIVTGKGPLENLADHLVDPVNNN 255          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB120_HORVU (Chlorophyll a-b binding protein 1B-20, chloroplastic (Fragment) OS=Hordeum vulgare GN=LHC Ib-20 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.437e-13
Identity = 54/158 (34.18%), Postives = 77/158 (48.73%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGVIPPAGTYNYWADPYTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNNVLTSL 475
            G + PE+L KAGL+    A  W +       G   Y+A   T   + M+   + E RR+QD  NPGS+ +     F+ Y     +  Y             + K       KE+ NGRLAMLA LG+ VQ  V G GP++NL  HLADP +N ++ ++
Sbjct:   88 GMLIPEVLTKAGLM---NAPEWLRL-----PGKETYFASSSTALRVHMSST-YVEIRRWQDIKNPGSVNQDPI--FKSYSLPPHECGYPGRVFNPLNFAPLENKE------KELANGRLAMLAFLGFLVQHNVHGKGPFENLQQHLADPWHNTIIQTI 228          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB2_CHLMO (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Chlamydomonas moewusii PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 5.863e-13
Identity = 59/168 (35.12%), Postives = 77/168 (45.83%), Query Frame = 2
Query:    2 GAIAPEILGK-AGLIPQETALAWFQTGV-IPPAGTYNYWADPYTL--------FVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEK-YLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNNVLTS 472
            G + PE+L   AG+   E    WF+ G  I   G  +Y   P  +          +++ LMG  E  R     N G  G     G +  Y G S DP               D  +  + K+KE+KNGRLAM +  G+FVQ +VTG GP QNL DHLADP  NN   +
Sbjct:  101 GILTPELLSTYAGVKFGEPV--WFKAGAQIFSEGGLDYLGSPALIHAQNIVATLAVQVVLMGLIEGYR----VNGGPAGE----GLDPLYPGESFDPL----------GLADDPDTFAELKVKEIKNGRLAMFSCFGFFVQAIVTGKGPIQNLADHLADPGTNNAFAA 248          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB121_HORVU (Chlorophyll a-b binding protein 1B-21, chloroplastic OS=Hordeum vulgare GN=LHC Ib-21 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.000e-12
Identity = 52/155 (33.55%), Postives = 72/155 (46.45%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGVIPPAGTYNYWADPYTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFV-QGLVTGVGPYQNLLDHLADPVNNNV 463
            G + PE LG    +  +   A    G     G    W +  T+  +E   + FAE +R  +  +P           +KY GG+ DP              KD    ++ KLKE+KNGRLAMLA +G+ V Q    G GP +NL  HLADP +NN+
Sbjct:  100 GVLVPEALGLGNWVKAQEWAA-LPDGQATYLGNPVPWGNLPTILAIEFLAIAFAEQQRTME-KDPEK---------KKYPGGAFDPL----------GFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNI 233          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB22_PINSY (Chlorophyll a-b binding protein type 2 member 2 (Fragment) OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.306e-12
Identity = 55/158 (34.81%), Postives = 77/158 (48.73%), Query Frame = 2
Query:   17 EILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEK-YLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            E+L K G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R       G +G     G +  Y G + DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPV NN
Sbjct:    1 ELLVKNGVKFGEAV--WFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYR----VGGGPLGE----GLDPLYPGDAFDPL----------GLADDPEAKAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVANN 138          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB23_SOLLC (Chlorophyll a-b binding protein 13, chloroplastic OS=Solanum lycopersicum GN=CAB13 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.706e-12
Identity = 53/162 (32.72%), Postives = 74/162 (45.68%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADPYTLFV--------LEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G I PE+L K   +  +  + WF+ G  I   G  +Y  +P  +           ++ LMG  E  R      PG               G G+  Y             D  +  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NLLDHL +PV NN
Sbjct:  109 GCIFPEVLEKWVKVDFKEPV-WFKAGSQIFSDGGLDYLGNPNLVHAQSILAVLGFQVVLMGLVEGFRINGL--PGV--------------GEGNDLYPGGQYFDPLGLADDPTTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANN 253          
The following BLAST results are available for this feature:
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
CB2A_SOLLC5.303e-1450.67Chlorophyll a-b binding protein 1A, chloroplastic ... [more]
CB21_PEA5.303e-1434.57Chlorophyll a-b binding protein AB96 (Fragment) OS... [more]
CB2F_SOLLC9.046e-1449.33Chlorophyll a-b binding protein 3B, chloroplastic ... [more]
CB2E_SOLLC9.046e-1449.33Chlorophyll a-b binding protein 3A, chloroplastic ... [more]
CB22_PETSP1.181e-1333.33Chlorophyll a-b binding protein 22L, chloroplastic... [more]
CB120_HORVU3.437e-1334.18Chlorophyll a-b binding protein 1B-20, chloroplast... [more]
CB2_CHLMO5.863e-1335.12Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB121_HORVU1.000e-1233.55Chlorophyll a-b binding protein 1B-21, chloroplast... [more]
CB22_PINSY1.306e-1234.81Chlorophyll a-b binding protein type 2 member 2 (F... [more]
CB23_SOLLC1.706e-1232.72Chlorophyll a-b binding protein 13, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00444 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00444 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623353 ID=BQ623353|Name=BQ623353|organism=Citrus sinensis|type=EST|length=562bp
GGGAGCCATTGCACCGGAGATTCTTGGCAAGGCAGGCCTCATTCCGCAAG
AAACTGCCCTGGCCTGGTTCCAAACCGGTGTGATCCCCCCAGCGGGAACA
TACAACTACTGGGCAGACCCTTACACACTTTTCGTCCTGGAAATGGCACT
CATGGGATTTGCCGAGCACCGGAGATTCCAAGACTGGGCAAATCCAGGAT
CAATGGGCAGGCAATACTTCCTCGGATTCGAGAAATACTTGGGAGGATCC
GGCGATCCGGCTTACCCTGGAGGACCTCTATTCAACCCTCTGGGTCTTGG
GAAAGATGAGAAGTCAATGAAGGATTTCAAGCTCAAGGAAGTGAAGAATG
GAAGATTGGCAATGTTGGCAATCTTGGGTTACTTTGTTCAAGGTCTTGTT
ACAGGAGTTGGGCCTTACCAGAACCTATTGGATCACTTGGCTGATCCTGT
AAACAACAATGTTTTGACTAGCCTATAGTTTCACTGAGAGAGAAATTTCT
TGTTCATTGCTTTGGAATTATATATTCCAAGCCTTGTCATCCCCCACTCT
GTTCTATTCTAC
back to top