BQ623353

Overview
NameBQ623353
Unique NameBQ623353
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length562
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9230 contig Csv1_Contig9230:445..1005. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB11_SOLLC (Chlorophyll a-b binding protein 6A, chloroplastic OS=Solanum lycopersicum GN=CAB6A PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.706e-12
Identity = 52/161 (32.30%), Postives = 72/161 (44.72%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGVIPPAGTYNYWADPY------TLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFV-QGLVTGVGPYQNLLDHLADPVNNNV 463
            G I PE LG    +  +   A        P G   Y   P       T+  +E   + F EH+R  +  +            +KY GG+ DP              KD    ++ K+KE+KNGRLA+LAI+G+ V Q    G GP +NL  HLADP +NN+
Sbjct:  101 GIIVPEALGLGNWVKAQEWAAI-------PGGQATYLGQPVPWGTLPTILAIEFLAIAFVEHQRSMEKDSEK----------KKYPGGAFDPL----------GYSKDPAKFEELKVKEIKNGRLALLAIVGFCVQQSAYLGTGPLENLATHLADPWHNNI 234          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB2_CHLRE (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Chlamydomonas reinhardtii GN=cabII-1 PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.228e-12
Identity = 57/163 (34.97%), Postives = 76/163 (46.63%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADPYTLFV--------LEMALMGFAEHRRFQDWANPGSMGRQYFLGFEK-YLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G   PE+L K+G    E    WF+ G  I   G  +Y  +P  +          +++ LMG  E  R     N G  G     G +  Y G S DP               D  +  + K+KE+KNGRLA  ++ G+FVQ +VTG GP QNL DHLA+P  NN
Sbjct:   99 GCQTPELLAKSGTKFGEAV--WFKAGAQIFSEGGLDYLGNPSLVHAQNIVATSAVQVILMGLIEGYR----VNGGPAGE----GLDPLYPGESFDPL----------GLADDPDTFAELKVKEIKNGRLASFSMFGFFVQAIVTGKGPVQNLDDHLANPTVNN 241          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB23_HORVU (Chlorophyll a-b binding protein of LHCII type III, chloroplastic OS=Hordeum vulgare GN=LHBC PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.910e-12
Identity = 55/165 (33.33%), Postives = 78/165 (47.27%), Query Frame = 2
Query:    2 GAIAPEILGK-AGLIPQETALAWFQTGV-IPPAGTYNYWADPYTLFV--------LEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKY--LGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L K  G+  +E    WF+ G  I   G  +Y  +P  +           ++ LMG  E  R       G  G   + G + +  LG + DP                  +  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHL DPV NN
Sbjct:  112 GCVFPEVLQKWVGVEFKEPV--WFKAGSQIFSEGGLDYLGNPNLVHAQSILAVLGFQVLLMGLVEGFRINGLDGVGE-GNDLYPGGQYFDPLGLADDPV-----------------TFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLFDHLDDPVANN 256          
The following BLAST results are available for this feature:
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
CB11_SOLLC1.706e-1232.30Chlorophyll a-b binding protein 6A, chloroplastic ... [more]
CB2_CHLRE2.228e-1234.97Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB23_HORVU2.910e-1233.33Chlorophyll a-b binding protein of LHCII type III,... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00444 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00444 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623353 ID=BQ623353|Name=BQ623353|organism=Citrus sinensis|type=EST|length=562bp
GGGAGCCATTGCACCGGAGATTCTTGGCAAGGCAGGCCTCATTCCGCAAG
AAACTGCCCTGGCCTGGTTCCAAACCGGTGTGATCCCCCCAGCGGGAACA
TACAACTACTGGGCAGACCCTTACACACTTTTCGTCCTGGAAATGGCACT
CATGGGATTTGCCGAGCACCGGAGATTCCAAGACTGGGCAAATCCAGGAT
CAATGGGCAGGCAATACTTCCTCGGATTCGAGAAATACTTGGGAGGATCC
GGCGATCCGGCTTACCCTGGAGGACCTCTATTCAACCCTCTGGGTCTTGG
GAAAGATGAGAAGTCAATGAAGGATTTCAAGCTCAAGGAAGTGAAGAATG
GAAGATTGGCAATGTTGGCAATCTTGGGTTACTTTGTTCAAGGTCTTGTT
ACAGGAGTTGGGCCTTACCAGAACCTATTGGATCACTTGGCTGATCCTGT
AAACAACAATGTTTTGACTAGCCTATAGTTTCACTGAGAGAGAAATTTCT
TGTTCATTGCTTTGGAATTATATATTCCAAGCCTTGTCATCCCCCACTCT
GTTCTATTCTAC
back to top