BQ623355

Overview
NameBQ623355
Unique NameBQ623355
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length619
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4610 contig Csv1_Contig4610:525..1143. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: MIP_BOVIN (Lens fiber major intrinsic protein OS=Bos taurus GN=MIP PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.211e-12
Identity = 49/154 (31.82%), Postives = 74/154 (48.05%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL---RASASKALGSFKSS 454
            LGA+ G  ++ +       R     N L  G S G     EI  T   V  +F+  D +RN R   V     L +GF++ + HL  +  TG G+NPARS   A++    + + + W++WVGP IGA + +  + F+L     S S+ L   K S
Sbjct:   95 LGAVAGAAVLYSVTPPA-VRGNLALNTLHPGVSVGQATIVEIFLTLQFVLCIFATYDERRNGRLGSVA----LAVGFSLTLGHLFGMYYTGAGMNPARSFAPAIL---TRNFTNHWVYWVGPVIGAGLGSLLYDFLLFPRLKSVSERLSILKGS 240          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP_DROME (Aquaporin OS=Drosophila melanogaster GN=Drip PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 1.211e-12
Identity = 43/140 (30.71%), Postives = 68/140 (48.57%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGG--GANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILR 415
            +GAI G  ++K          GG  G +      +    +  E + TF+LV+ V + +DP R      +   APL +G A+   HL  I ++G  +NPARS G AV+   +  W   W++WVGP  G  +A   ++ I +
Sbjct:  103 VGAIAGAAVIKVALDGVA---GGDLGVSSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGRQ----DIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVV---QGVWTYHWVYWVGPIAGGLLAGIIYRLIFK 232          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP23_MAIZE (Aquaporin TIP2-3 OS=Zea mays GN=TIP2-3 PE=2 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 1.581e-12
Identity = 50/141 (35.46%), Postives = 70/141 (49.65%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAS 421
            LGA   C L++     Y T           G S   G+  EI+ TF LVYTV++ A DPK+ +    +  +AP+ IGF V    LA  P +G  +NPARS G AV       +   W++WVGP +G  +A   +  +  AS
Sbjct:  110 LGASVACFLLQ-----YVTHGQAIPTHGVSGISEIEGVVMEIVITFALVYTVYATAADPKKGS----LGTIAPMAIGFIVGANILAAGPFSGGSMNPARSFGPAVAAGN---FAGNWVYWVGPLVGGGLAGLVYGDVFIAS 238          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP12_ARATH (Aquaporin TIP1-2 OS=Arabidopsis thaliana GN=TIP1-2 PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 1.581e-12
Identity = 51/141 (36.17%), Postives = 72/141 (51.06%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTG----LGAEIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFI 409
            LG++  C L+     S+ T   GG    A G S G G    L  EI+ TF LVYTV++ A DPK  +    +  +AP+ IGF V    LA    +G  +NPA + G AV+      W + W++W GP IG  +A   + F+
Sbjct:  113 LGSVAACFLL-----SFAT---GGEPIPAFGLSAGVGSLNALVFEIVMTFGLVYTVYATAVDPKNGS----LGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFGPAVV---SWTWTNHWVYWAGPLIGGGLAGIIYDFV 238          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIPA_PHAVU (Probable aquaporin TIP-type alpha OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.065e-12
Identity = 44/108 (40.74%), Postives = 62/108 (57.41%), Query Frame = 2
Query:   98 STGTGLG----AEIIGTFVLVYTVF-SATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQF 406
            S G G+G     E++ TF L+YTV+ +A DPKR A    V  +APL IG  V    L   P  G  +NPA + G +++  +   W   WIFWVGP +GAA+AA  +++
Sbjct:  136 SPGVGVGHMFILEVVMTFGLMYTVYGTAIDPKRGA----VSYIAPLAIGLIVGANILVGGPFDGACMNPALAFGPSLVGWQ---WHQHWIFWVGPLLGAALAALVYEY 236          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: MIP_SHEEP (Lens fiber major intrinsic protein OS=Ovis aries GN=MIP PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.065e-12
Identity = 44/137 (32.12%), Postives = 68/137 (49.64%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            LGA+ G  ++ +       R     N L  G S G     EI  T   V  +F+  D +RN R   V     L +GF++ + HL  +  TG G+NPARS   A++    + + + W++WVGP IGA + +  + F+L
Sbjct:   95 LGAVAGAAVLYSVTPPA-VRGNLALNTLHPGVSVGQATIVEIFLTLQFVLCIFATYDERRNGRLGSVA----LAVGFSLTLGHLFGMYYTGAGMNPARSFAPAIL---TRNFTNHWVYWVGPVIGAGLGSLLYDFLL 223          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: MIP_RAT (Lens fiber major intrinsic protein (Fragment) OS=Rattus norvegicus GN=Mip PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 2.065e-12
Identity = 43/137 (31.39%), Postives = 67/137 (48.91%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            LGA+ G  ++ +       R     N L  G S G     EI  T   V  +F+  D +RN R   V     L +GF++ + HL  +  TG G+NPARS   A++    + + + W++WVGP IG  + +  + F+L
Sbjct:   93 LGAVAGAAVLYSVTPPA-VRGNLALNTLHAGVSVGQATTVEIFLTLQFVLCIFATYDERRNGRMGSVA----LAVGFSLTLGHLFGMYYTGAGMNPARSFAPAIL---TRNFSNHWVYWVGPIIGGGLGSLLYDFLL 221          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: MIP_RANPI (Lens fiber major intrinsic protein OS=Rana pipiens PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.065e-12
Identity = 46/137 (33.58%), Postives = 66/137 (48.18%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            LGA+ G  ++     +   R     N L  G S G     EI  T   V  +F+  D +RN R   V     L IGF++ + HL  +  TG  +NPARS   AV+    + + + W++WVGP IG A+    + FIL
Sbjct:   95 LGAVAGAAVLYGVTPAAI-RGNLALNTLHPGVSLGQATTVEIFLTLQFVLCIFATYDERRNGRLGSVS----LAIGFSLTLGHLFGLYYTGASMNPARSFAPAVL---TRNFTNHWVYWVGPIIGGALGGLVYDFIL 223          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: MIP_MOUSE (Lens fiber major intrinsic protein OS=Mus musculus GN=Mip PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 2.065e-12
Identity = 43/137 (31.39%), Postives = 67/137 (48.91%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            LGA+ G  ++ +       R     N L  G S G     EI  T   V  +F+  D +RN R   V     L +GF++ + HL  +  TG G+NPARS   A++    + + + W++WVGP IG  + +  + F+L
Sbjct:   95 LGAVAGAAVLYSVTPPA-VRGNLALNTLHAGVSVGQATTVEIFLTLQFVLCIFATYDERRNGRMGSVA----LAVGFSLTLGHLFGMYYTGAGMNPARSFAPAIL---TRNFSNHWVYWVGPIIGGGLGSLLYDFLL 223          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP23_ARATH (Aquaporin TIP2-3 OS=Arabidopsis thaliana GN=TIP2-3 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.697e-12
Identity = 44/109 (40.37%), Postives = 60/109 (55.05%), Query Frame = 2
Query:   95 YSTGTGLGA------EIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYH 400
            +    GLGA      EI+ TF LVYTV++ A DPK+ +    +  +AP+ IGF V    LA  P +G  +NPARS G AV+          WI+WVGP +G A+A   +
Sbjct:  131 HGVSAGLGAVEGVVMEIVVTFALVYTVYATAADPKKGS----LGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGD---LSQIWIYWVGPLVGGALAGLIY 232          
The following BLAST results are available for this feature:
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 134
Match NameE-valueIdentityDescription
MIP_BOVIN1.211e-1231.82Lens fiber major intrinsic protein OS=Bos taurus G... [more]
AQP_DROME1.211e-1230.71Aquaporin OS=Drosophila melanogaster GN=Drip PE=1 ... [more]
TIP23_MAIZE1.581e-1235.46Aquaporin TIP2-3 OS=Zea mays GN=TIP2-3 PE=2 SV=2[more]
TIP12_ARATH1.581e-1236.17Aquaporin TIP1-2 OS=Arabidopsis thaliana GN=TIP1-2... [more]
TIPA_PHAVU2.065e-1240.74Probable aquaporin TIP-type alpha OS=Phaseolus vul... [more]
MIP_SHEEP2.065e-1232.12Lens fiber major intrinsic protein OS=Ovis aries G... [more]
MIP_RAT2.065e-1231.39Lens fiber major intrinsic protein (Fragment) OS=R... [more]
MIP_RANPI2.065e-1233.58Lens fiber major intrinsic protein OS=Rana pipiens... [more]
MIP_MOUSE2.065e-1231.39Lens fiber major intrinsic protein OS=Mus musculus... [more]
TIP23_ARATH2.697e-1240.37Aquaporin TIP2-3 OS=Arabidopsis thaliana GN=TIP2-3... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00446 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00446 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623355 ID=BQ623355|Name=BQ623355|organism=Citrus sinensis|type=EST|length=619bp
TTTGGGAGCCATATGTGGCTGCGGGCTCGTTAAGGCTTTCCAGAAGTCTT
ACTACACGAGATACGGCGGTGGAGCCAATGAGCTCGCTGATGGGTACAGC
ACTGGCACTGGATTGGGTGCTGAGATCATCGGTACCTTTGTTCTTGTCTA
CACTGTTTTCTCCGCCACTGATCCCAAGAGAAATGCTAGGGACTCCCACG
TTCCCGTCTTGGCGCCATTGCCAATTGGATTTGCTGTGTTCATGGTTCAC
TTGGCTACGATCCCTGTCACTGGAACTGGCATCAACCCCGCTAGAAGTTT
GGGAGCTGCAGTGATTTACAGCAAGGAGAAGGCTTGGGATGATCAATGGA
TCTTCTGGGTTGGCCCCTTCATTGGTGCTGCAATTGCTGCATTTTACCAC
CAATTCATCCTCAGAGCATCTGCTTCTAAAGCTCTTGGATCCTTCAAAAG
CTCCTCCAACATTTAATTAACTTTTAAAATAATTACTGGAGGATTAATCA
ATGGCTGTCAAGCGGCTTCGCGACTATGGAATTTGTACATTGTTTTATTT
GCATCAGTATTTAGTATAGCTGGTGTAGATCCCGCAGCACTTTGTGTGTG
TCTTTTGTTTACCTGAGGA
back to top