BQ623355

Overview
NameBQ623355
Unique NameBQ623355
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length619
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4610 contig Csv1_Contig4610:525..1143. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP22_ORYSJ (Probable aquaporin TIP2-2 OS=Oryza sativa subsp. japonica GN=TIP2-2 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.697e-12
Identity = 49/137 (35.77%), Postives = 70/137 (51.09%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFI 409
            LGAI G  LV+         +G        G     G+  EII TF LVYTV++ A DPK+ +    +  +AP+ IGF V    L   P +G  +NPARS G AV       + + WI+WVGP +G  +A   ++++
Sbjct:  111 LGAIVGAVLVQFCTGVATPTHG------LSGVGAFEGVVMEIIVTFGLVYTVYATAADPKKGS----LGTIAPIAIGFIVGANILVAGPFSGGSMNPARSFGPAVASGD---YTNIWIYWVGPLVGGGLAGLVYRYV 234          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP21_ORYSJ (Probable aquaporin TIP2-1 OS=Oryza sativa subsp. japonica GN=TIP2-1 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.697e-12
Identity = 51/136 (37.50%), Postives = 70/136 (51.47%), Query Frame = 2
Query:    2 LGAICGCGLVK--AFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYH 400
            LGA   C L+K     K+  T    G +EL        G+  EI+ TF LVYTV++ A DPK+ +    +  +AP+ IGF V    LA  P +G  +NPARS G AV       +   W++WVGP IG  +A   +
Sbjct:  110 LGASIACLLLKFVTHGKAIPTHGVAGISELE-------GVVMEIVITFALVYTVYATAADPKKGS----LGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVAAGN---FAGNWVYWVGPLIGGGLAGLVY 231          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: MIP_CANFA (Lens fiber major intrinsic protein OS=Canis familiaris GN=MIP PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.697e-12
Identity = 43/137 (31.39%), Postives = 67/137 (48.91%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            LGA+ G  ++ +       R     N L  G S G     EI  T   V  +F+  D +RN R   V     L +GF++ + HL  +  TG G+NPARS   A++    + + + W++WVGP IG  + +  + F+L
Sbjct:   95 LGAVAGAAVLYSVTPPA-VRGNLALNTLHPGVSVGQATTVEIFLTLQFVLCIFATYDERRNGRLGSVA----LAVGFSLTLGHLFGMYYTGAGMNPARSFAPAIL---TRNFTNHWVYWVGPIIGGGLGSLLYDFLL 223          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ_VIBVY (Aquaporin Z OS=Vibrio vulnificus (strain YJ016) GN=aqpZ PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.697e-12
Identity = 38/106 (35.85%), Postives = 57/106 (53.77%), Query Frame = 2
Query:   92 GYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFI 409
            GYS  + L  EI+   + +  +  ATD +           AP+ IG  + ++HL +IPVT T +NPARS G A +Y  + A    W+FWV P +GA + A  ++ I
Sbjct:  127 GYSLTSALVTEIVMAMMFLLVILGATDQRAPQG------FAPIAIGLCLTLIHLISIPVTNTSVNPARSTGVA-LYVGDWATAQLWLFWVAPILGALLGAVAYKLI 225          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ2_RHIME (Aquaporin Z 2 OS=Rhizobium meliloti GN=aqpZ2 PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 3.523e-12
Identity = 43/118 (36.44%), Postives = 61/118 (51.69%), Query Frame = 2
Query:   38 FQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV-LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIA 388
            FQ   +   G G +    GYS    L  E++ TF  +  +  +T  +       VP   AP+ IG A+ ++HL +IPVT T +NPARS G A ++    A    W+FW+ P  GAAIA
Sbjct:  109 FQLGSFAANGYGEHS-PGGYSLTAALVTEVVMTFFFLIIILGSTHRR-------VPAGFAPIAIGLALTLIHLVSIPVTNTSVNPARSTGQA-LFVGGWALSQLWLFWIAPLFGAAIA 217          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ1_RHIME (Aquaporin Z 1 OS=Rhizobium meliloti GN=aqpZ1 PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 3.523e-12
Identity = 44/125 (35.20%), Postives = 63/125 (50.40%), Query Frame = 2
Query:   38 FQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPV-LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFI 409
            FQ   +   G G +    GYS    L  E++ T   +  +  +T        S VPV  AP+ IG  + ++HL +IPVT T +NPARS G A ++  + A    W+FWV P IGA IA    + +
Sbjct:  109 FQLGGFAANGYGEHS-PGGYSLTAALVTEVVMTAFFLLIILGSTH-------SRVPVGFAPIAIGLGLTLIHLVSIPVTNTSVNPARSTGQA-LFVGDWAISQLWLFWVAPLIGAVIAGIVWKIV 224          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ_SYNY3 (Aquaporin Z OS=Synechocystis sp. (strain PCC 6803) GN=aqpZ PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.601e-12
Identity = 37/115 (32.17%), Postives = 54/115 (46.96%), Query Frame = 2
Query:   68 GGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            G  +    GY     L  E + TF+ +  +   TD    A        AP  IG A+ ++HL +IP+T T +NPARS G A+           W+FW+ P  GA +A F +  +L
Sbjct:  128 GFGDHSPQGYGFLAALLIEFVLTFIFLIVILGVTDKTAPAG------FAPAAIGLALTLIHLISIPITNTSVNPARSTGVALFCGNPALIGQLWLFWLAPIAGALLAGFVYHNVL 236          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPA_DICDI (Aquaporin A OS=Dictyostelium discoideum GN=aqpA PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 7.848e-12
Identity = 43/138 (31.16%), Postives = 68/138 (49.28%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILR 415
            LG I G G++     + Y R   G   LA G +TG     E++ T +L   V   +    N  D  +  +AP  IG A+F+        +G  +NP R LG ++I      W   W++W+GP +GA +AAF ++ +L+
Sbjct:  123 LGCIAGAGILYGCLPNMY-RIDLGVPHLAPGMNTGQAFLMEMMLTSILCLCVLGTS--VFNVWDRRLNRIAPFAIGLALFIGVAIGFNFSGGALNPVRVLGPSIISG---VWSHHWVYWLGPIVGAILAAFIYRCLLQ 254          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP6_RAT (Aquaporin-6 OS=Rattus norvegicus GN=Aqp6 PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 7.848e-12
Identity = 43/114 (37.72%), Postives = 58/114 (50.88%), Query Frame = 2
Query:   71 GANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            G N + +  STG  +  E++ T  LV  VF++ D ++              IG +V + HL  I  TG  +NPARS G AVI  K       WIFWVGP  GA +A+  + FIL
Sbjct:  128 GVNVVHNSTSTGQAVAVELVLTLQLVLCVFASMDSRQTLGSPAAM------IGTSVALGHLIGIYFTGCSMNPARSFGPAVIVGKFAV---HWIFWVGPLTGAVLASLIYNFIL 232          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP6_MOUSE (Aquaporin-6 OS=Mus musculus GN=Aqp6 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 7.848e-12
Identity = 43/114 (37.72%), Postives = 58/114 (50.88%), Query Frame = 2
Query:   71 GANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            G N + +  STG  +  E++ T  LV  VF++ D ++              IG +V + HL  I  TG  +NPARS G AVI  K       WIFWVGP  GA +A+  + FIL
Sbjct:  128 GVNVVHNSTSTGQAVAVELVLTLQLVLCVFASMDGRQTLASPAAM------IGTSVALGHLIGIYFTGCSMNPARSFGPAVIVGKFAV---HWIFWVGPLTGAVLASLIYNFIL 232          
The following BLAST results are available for this feature:
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 134
Match NameE-valueIdentityDescription
TIP22_ORYSJ2.697e-1235.77Probable aquaporin TIP2-2 OS=Oryza sativa subsp. j... [more]
TIP21_ORYSJ2.697e-1237.50Probable aquaporin TIP2-1 OS=Oryza sativa subsp. j... [more]
MIP_CANFA2.697e-1231.39Lens fiber major intrinsic protein OS=Canis famili... [more]
AQPZ_VIBVY2.697e-1235.85Aquaporin Z OS=Vibrio vulnificus (strain YJ016) GN... [more]
AQPZ2_RHIME3.523e-1236.44Aquaporin Z 2 OS=Rhizobium meliloti GN=aqpZ2 PE=3 ... [more]
AQPZ1_RHIME3.523e-1235.20Aquaporin Z 1 OS=Rhizobium meliloti GN=aqpZ1 PE=3 ... [more]
AQPZ_SYNY34.601e-1232.17Aquaporin Z OS=Synechocystis sp. (strain PCC 6803)... [more]
AQPA_DICDI7.848e-1231.16Aquaporin A OS=Dictyostelium discoideum GN=aqpA PE... [more]
AQP6_RAT7.848e-1237.72Aquaporin-6 OS=Rattus norvegicus GN=Aqp6 PE=1 SV=1[more]
AQP6_MOUSE7.848e-1237.72Aquaporin-6 OS=Mus musculus GN=Aqp6 PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00446 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00446 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623355 ID=BQ623355|Name=BQ623355|organism=Citrus sinensis|type=EST|length=619bp
TTTGGGAGCCATATGTGGCTGCGGGCTCGTTAAGGCTTTCCAGAAGTCTT
ACTACACGAGATACGGCGGTGGAGCCAATGAGCTCGCTGATGGGTACAGC
ACTGGCACTGGATTGGGTGCTGAGATCATCGGTACCTTTGTTCTTGTCTA
CACTGTTTTCTCCGCCACTGATCCCAAGAGAAATGCTAGGGACTCCCACG
TTCCCGTCTTGGCGCCATTGCCAATTGGATTTGCTGTGTTCATGGTTCAC
TTGGCTACGATCCCTGTCACTGGAACTGGCATCAACCCCGCTAGAAGTTT
GGGAGCTGCAGTGATTTACAGCAAGGAGAAGGCTTGGGATGATCAATGGA
TCTTCTGGGTTGGCCCCTTCATTGGTGCTGCAATTGCTGCATTTTACCAC
CAATTCATCCTCAGAGCATCTGCTTCTAAAGCTCTTGGATCCTTCAAAAG
CTCCTCCAACATTTAATTAACTTTTAAAATAATTACTGGAGGATTAATCA
ATGGCTGTCAAGCGGCTTCGCGACTATGGAATTTGTACATTGTTTTATTT
GCATCAGTATTTAGTATAGCTGGTGTAGATCCCGCAGCACTTTGTGTGTG
TCTTTTGTTTACCTGAGGA
back to top