BQ623355

Overview
NameBQ623355
Unique NameBQ623355
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length619
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4610 contig Csv1_Contig4610:525..1143. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP22_MAIZE (Aquaporin TIP2-2 OS=Zea mays GN=TIP2-2 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.025e-11
Identity = 44/108 (40.74%), Postives = 61/108 (56.48%), Query Frame = 2
Query:   92 GYSTGT----GLGAEIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYH 400
            G S GT    G+  EI+ TF LVYTV++ A DPK+ +    +  +AP+ IGF V    LA  P +G  +NPARS G AV  +    +   W++WVGP IG  +A   +
Sbjct:  132 GVSGGTTELEGVVFEIVITFALVYTVYATAADPKKGS----LGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVAAAD---FAGNWVYWVGPLIGGGLAGLVY 232          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP11_ORYSJ (Probable aquaporin TIP1-1 OS=Oryza sativa subsp. japonica GN=TIP1-1 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.025e-11
Identity = 40/107 (37.38%), Postives = 59/107 (55.14%), Query Frame = 2
Query:   92 GYSTGTGLGAEIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFI 409
            G S    L  EI+ TF LVYTV++ A DPK+ +    +  +AP+ IGF V    L      G  +NPA S G A++     +W+ QW++WVGP IG  +A   ++ +
Sbjct:  137 GVSVWEALVLEIVMTFGLVYTVYATAVDPKKGS----LGTIAPIAIGFIVGANILVGGAFDGASMNPAVSFGPALV---SWSWESQWVYWVGPLIGGGLAGVIYEVL 236          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ_BRAJA (Aquaporin Z OS=Bradyrhizobium japonicum GN=aqpZ PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.025e-11
Identity = 41/131 (31.30%), Postives = 65/131 (49.62%), Query Frame = 2
Query:   17 GCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFI 409
            G  + K F  + Y  +  G   +   + T      E++ T + ++ +  AT  +  A        APL IG A+ M+HL +IPVT T +NPARS G A ++    A    W+FWV P IG A+    ++++
Sbjct:  109 GFDVTKGFASNGYDAHSPGQYSMMACFLT------EVVMTMMFLFIIMGATHGRAPAG------FAPLAIGLALVMIHLVSIPVTNTSVNPARSTGPA-LFVGGWAMAQLWLFWVAPLIGGALGGVIYRWL 226          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ_PSEAE (Aquaporin Z OS=Pseudomonas aeruginosa GN=aqpZ PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.339e-11
Identity = 43/131 (32.82%), Postives = 65/131 (49.62%), Query Frame = 2
Query:   17 GCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFI 409
            G  L   F  + Y  +  G      GYS    L +E++ T + +  +  AT  KR  +       AP+ IG  + ++HL +IPVT T +NPARS  A  +Y  + A    W+FWV P +GA + A  ++ I
Sbjct:  107 GFDLAAGFASNGYGEHSPG------GYSLQAALVSEVVLTGMFLLIILGATS-KRAPQG-----FAPIAIGLTLTLIHLISIPVTNTSVNPARST-AVALYVGDWAVSQLWLFWVAPILGAVLGALAYRLI 224          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP51_ARATH (Probable aquaporin TIP5-1 OS=Arabidopsis thaliana GN=TIP5-1 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.748e-11
Identity = 41/106 (38.68%), Postives = 63/106 (59.43%), Query Frame = 2
Query:  107 TGLGAEIIG---TFVLVYTVFSATDPKRNARDSHVPV-LAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            TG GA ++     FVLVYTVF+A+DP+R      +P+ + P+ IGF      LA  P +G  +NPA + G+A++Y   K   +Q ++WVGP +G A AA  +  ++
Sbjct:  142 TGFGASVLEGVLAFVLVYTVFTASDPRRG-----LPLAVGPIFIGFVAGANVLAAGPFSGGSMNPACAFGSAMVYGSFK---NQAVYWVGPLLGGATAALVYDNVV 239          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP21_MAIZE (Aquaporin TIP2-1 OS=Zea mays GN=TIP2-1 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.284e-11
Identity = 40/104 (38.46%), Postives = 58/104 (55.77%), Query Frame = 2
Query:   92 GYSTGTGLGAEIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYH 400
            G S   G+  E++ TF LVYTV++ A DPK+ +    +  +AP+ IGF V    LA  P +G  +NPARS G AV       +   W++WVGP +G  +A   +
Sbjct:  135 GISELEGVVFEVVITFALVYTVYATAADPKKGS----LGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVAAGD---FAGNWVYWVGPLVGGGLAGLVY 231          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: MIP_CAVPO (Lens fiber major intrinsic protein OS=Cavia porcellus GN=MIP PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.284e-11
Identity = 42/137 (30.66%), Postives = 66/137 (48.18%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            LGA+ G  ++ +       R     N L  G S       EI  T   V  +F+  D +RN R   V     L +GF++ + HL  +  TG G+NPARS   A++    + + + W++WVGP IG  + +  + F+L
Sbjct:   95 LGAVAGAAVLYSVTPPA-VRGNLALNTLHAGVSVXQATTVEIFLTLQFVLCIFATYDERRNGRLGSVA----LAVGFSLTLGHLFGMYYTGAGMNPARSFAPAIL---TRNFTNHWVYWVGPIIGGGLGSLLYDFLL 223          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP11_ARATH (Aquaporin TIP1-1 OS=Arabidopsis thaliana GN=TIP1-1 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.982e-11
Identity = 49/139 (35.25%), Postives = 70/139 (50.36%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTG-LGA---EIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQ 403
            LG++  C ++K           GG    A G S G G L A   EI+ TF LVYTV++ A DPK  +    +  +AP+ IGF V    LA    +G  +NPA + G AV+      W + W++W GP +G  IA   ++
Sbjct:  112 LGSVVACLILKFAT--------GGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGS----LGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFGPAVV---SWTWTNHWVYWAGPLVGGGIAGLIYE 235          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ_SHEON (Aquaporin Z OS=Shewanella oneidensis GN=aqpZ PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.982e-11
Identity = 41/141 (29.08%), Postives = 70/141 (49.65%), Query Frame = 2
Query:    5 GAICGCG---LVKAFQKSYYTRYGGGANELAD----GYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQF 406
            G I G G   L+ + Q+ +    G  +N   +    GYS  + +  EI+ T   +  +  +TD +           AP+ IG  + ++HL +IP++ T +NPARS G A ++  + A    W+FW  P IGA +A   +++
Sbjct:   91 GGIAGAGVLYLIASGQEGFSLAAGFASNGFGEHSPGGYSMISVMICEIVMTLFFLLVILGSTDERAPKG------FAPIAIGLCLTLIHLISIPISNTSVNPARSTGPA-LFVGDWAVSQLWLFWAAPIIGAILAGVIYRY 224          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ_RHOPA (Aquaporin Z OS=Rhodopseudomonas palustris GN=aqpZ PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.982e-11
Identity = 46/150 (30.67%), Postives = 70/150 (46.67%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGA--------------EIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFI 409
            LGAI    L+      Y    G    +LA G+++  G GA              E++ T + ++ +  +T  K  A        APL IG A+ M+HL +IPVT T +NPARS G A ++    A    W+FWV P +G  +    ++ +
Sbjct:   91 LGAIAAAALL------YLIASGAAGFDLAKGFASN-GYGAHSPGQYNLVACFVMEVVMTMMFLFVIMGSTHGKAPAG------FAPLAIGLALVMIHLVSIPVTNTSVNPARSTGPA-LFVGGWAIGQLWLFWVAPLLGGVLGGVIYRVL 226          
The following BLAST results are available for this feature:
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 134
Match NameE-valueIdentityDescription
TIP22_MAIZE1.025e-1140.74Aquaporin TIP2-2 OS=Zea mays GN=TIP2-2 PE=2 SV=1[more]
TIP11_ORYSJ1.025e-1137.38Probable aquaporin TIP1-1 OS=Oryza sativa subsp. j... [more]
AQPZ_BRAJA1.025e-1131.30Aquaporin Z OS=Bradyrhizobium japonicum GN=aqpZ PE... [more]
AQPZ_PSEAE1.339e-1132.82Aquaporin Z OS=Pseudomonas aeruginosa GN=aqpZ PE=3... [more]
TIP51_ARATH1.748e-1138.68Probable aquaporin TIP5-1 OS=Arabidopsis thaliana ... [more]
TIP21_MAIZE2.284e-1138.46Aquaporin TIP2-1 OS=Zea mays GN=TIP2-1 PE=2 SV=1[more]
MIP_CAVPO2.284e-1130.66Lens fiber major intrinsic protein OS=Cavia porcel... [more]
TIP11_ARATH2.982e-1135.25Aquaporin TIP1-1 OS=Arabidopsis thaliana GN=TIP1-1... [more]
AQPZ_SHEON2.982e-1129.08Aquaporin Z OS=Shewanella oneidensis GN=aqpZ PE=3 ... [more]
AQPZ_RHOPA2.982e-1130.67Aquaporin Z OS=Rhodopseudomonas palustris GN=aqpZ ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00446 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00446 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623355 ID=BQ623355|Name=BQ623355|organism=Citrus sinensis|type=EST|length=619bp
TTTGGGAGCCATATGTGGCTGCGGGCTCGTTAAGGCTTTCCAGAAGTCTT
ACTACACGAGATACGGCGGTGGAGCCAATGAGCTCGCTGATGGGTACAGC
ACTGGCACTGGATTGGGTGCTGAGATCATCGGTACCTTTGTTCTTGTCTA
CACTGTTTTCTCCGCCACTGATCCCAAGAGAAATGCTAGGGACTCCCACG
TTCCCGTCTTGGCGCCATTGCCAATTGGATTTGCTGTGTTCATGGTTCAC
TTGGCTACGATCCCTGTCACTGGAACTGGCATCAACCCCGCTAGAAGTTT
GGGAGCTGCAGTGATTTACAGCAAGGAGAAGGCTTGGGATGATCAATGGA
TCTTCTGGGTTGGCCCCTTCATTGGTGCTGCAATTGCTGCATTTTACCAC
CAATTCATCCTCAGAGCATCTGCTTCTAAAGCTCTTGGATCCTTCAAAAG
CTCCTCCAACATTTAATTAACTTTTAAAATAATTACTGGAGGATTAATCA
ATGGCTGTCAAGCGGCTTCGCGACTATGGAATTTGTACATTGTTTTATTT
GCATCAGTATTTAGTATAGCTGGTGTAGATCCCGCAGCACTTTGTGTGTG
TCTTTTGTTTACCTGAGGA
back to top