BQ623355

Overview
NameBQ623355
Unique NameBQ623355
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length619
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4610 contig Csv1_Contig4610:525..1143. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ_PHOLL (Aquaporin Z OS=Photorhabdus luminescens subsp. laumondii GN=aqpZ PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.982e-11
Identity = 36/106 (33.96%), Postives = 57/106 (53.77%), Query Frame = 2
Query:   92 GYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFI 409
            G+S  + + AEI+ T + +  +  ATD +        P  APL IG A+ +++L +IP+T T +NPARS  A  I+    A +  W FWV P IG  +    ++ +
Sbjct:  128 GFSLQSAIVAEIVLTAIFLIVIIGATDRRAP------PGFAPLAIGLALVLINLISIPITNTSVNPARST-AVAIFQNTWALEQLWFFWVMPIIGGIVGGGIYRLL 226          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP11_MAIZE (Aquaporin TIP1-1 OS=Zea mays GN=TIP1-1 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.895e-11
Identity = 42/118 (35.59%), Postives = 62/118 (52.54%), Query Frame = 2
Query:   92 GYSTGTGLGAEIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKALGS 442
            G S    L  EI+ TF LVYTV++ A DPK+ +    +  +AP+ IGF V    L      G  +NPA S G A++  +   W  QW++WVGP IG  +A   ++ +  +   + L S
Sbjct:  137 GVSVWEALVLEIVMTFGLVYTVYATAVDPKKGS----LGTIAPIAIGFIVGANILVGGAFDGASMNPAVSFGPALVSWE---WGYQWVYWVGPLIGGGLAGVIYELLFISHTHEQLPS 247          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ_VIBPA (Aquaporin Z OS=Vibrio parahaemolyticus GN=aqpZ PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.895e-11
Identity = 38/106 (35.85%), Postives = 58/106 (54.72%), Query Frame = 2
Query:   95 YSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            YS    L +EI+ T + +  +  ATD KR  +       AP+ IG  + ++HL +IPVT T +NPARS  A  +Y  + A    W+FWV P +G  + A  ++ +L
Sbjct:  128 YSMLAALVSEIVMTMMFLIVIMGATD-KRAPQG-----FAPIAIGLCLTLIHLISIPVTNTSVNPARST-AVAMYVGDWAVSQLWLFWVAPIVGGVLGAVIYKNLL 226          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: MIP_HUMAN (Lens fiber major intrinsic protein OS=Homo sapiens GN=MIP PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 5.087e-11
Identity = 41/137 (29.93%), Postives = 65/137 (47.45%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            LGA+ G  ++ +       R     N L    S G     EI  T   V  +F+  D +RN +   V     L +GF++ + HL  +  TG G+NPARS   A++      + + W++WVGP IG  + +  + F+L
Sbjct:   95 LGAVAGAAVLYSVTPPA-VRGNLALNTLHPAVSVGQATTVEIFLTLQFVLCIFATYDERRNGQLGSVA----LAVGFSLALGHLFGMYYTGAGMNPARSFAPAILTGN---FTNHWVYWVGPIIGGGLGSLLYDFLL 223          
The following BLAST results are available for this feature:
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 134
Match NameE-valueIdentityDescription
AQPZ_PHOLL2.982e-1133.96Aquaporin Z OS=Photorhabdus luminescens subsp. lau... [more]
TIP11_MAIZE3.895e-1135.59Aquaporin TIP1-1 OS=Zea mays GN=TIP1-1 PE=2 SV=1[more]
AQPZ_VIBPA3.895e-1135.85Aquaporin Z OS=Vibrio parahaemolyticus GN=aqpZ PE=... [more]
MIP_HUMAN5.087e-1129.93Lens fiber major intrinsic protein OS=Homo sapiens... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00446 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00446 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623355 ID=BQ623355|Name=BQ623355|organism=Citrus sinensis|type=EST|length=619bp
TTTGGGAGCCATATGTGGCTGCGGGCTCGTTAAGGCTTTCCAGAAGTCTT
ACTACACGAGATACGGCGGTGGAGCCAATGAGCTCGCTGATGGGTACAGC
ACTGGCACTGGATTGGGTGCTGAGATCATCGGTACCTTTGTTCTTGTCTA
CACTGTTTTCTCCGCCACTGATCCCAAGAGAAATGCTAGGGACTCCCACG
TTCCCGTCTTGGCGCCATTGCCAATTGGATTTGCTGTGTTCATGGTTCAC
TTGGCTACGATCCCTGTCACTGGAACTGGCATCAACCCCGCTAGAAGTTT
GGGAGCTGCAGTGATTTACAGCAAGGAGAAGGCTTGGGATGATCAATGGA
TCTTCTGGGTTGGCCCCTTCATTGGTGCTGCAATTGCTGCATTTTACCAC
CAATTCATCCTCAGAGCATCTGCTTCTAAAGCTCTTGGATCCTTCAAAAG
CTCCTCCAACATTTAATTAACTTTTAAAATAATTACTGGAGGATTAATCA
ATGGCTGTCAAGCGGCTTCGCGACTATGGAATTTGTACATTGTTTTATTT
GCATCAGTATTTAGTATAGCTGGTGTAGATCCCGCAGCACTTTGTGTGTG
TCTTTTGTTTACCTGAGGA
back to top