BQ623355

Overview
NameBQ623355
Unique NameBQ623355
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length619
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4610 contig Csv1_Contig4610:525..1143. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP1_HUMAN (Aquaporin-1 OS=Homo sapiens GN=AQP1 PE=1 SV=3)

HSP 1 Score: 107.071 bits (266), Expect = 7.567e-23
Identity = 66/142 (46.48%), Postives = 83/142 (58.45%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASAS 427
            +GAI    ++     S  T    G N+LADG ++G GLG EIIGT  LV  V + TD +R  RD  +   APL IG +V + HL  I  TG GINPARS G+AVI      + + WIFWVGPFIG A+A   + FIL   +S
Sbjct:  103 VGAIVATAILSGITSSL-TGNSLGRNDLADGVNSGQGLGIEIIGTLQLVLCVLATTDRRR--RD--LGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHN---FSNHWIFWVGPFIGGALAVLIYDFILAPRSS 236          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP1_SHEEP (Aquaporin-1 OS=Ovis aries GN=AQP1 PE=2 SV=3)

HSP 1 Score: 105.916 bits (263), Expect = 1.686e-22
Identity = 61/119 (51.26%), Postives = 74/119 (62.18%), Query Frame = 2
Query:   71 GANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASAS 427
            G N LA G ++G GLG EIIGT  LV  V + TD +R  RD  +    PL IGF+V + HL  I  TG GINPARS G++VI      + D WIFWVGPFIGAA+A   + FIL   +S
Sbjct:  127 GLNALAPGVNSGQGLGIEIIGTLQLVLCVLATTD-RRRRRD--LGDSGPLAIGFSVALGHLLAIDYTGCGINPARSFGSSVITHN---FQDHWIFWVGPFIGAALAVLIYDFILAPRSS 239          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP1_PONAB (Aquaporin-1 OS=Pongo abelii GN=AQP1 PE=2 SV=3)

HSP 1 Score: 105.916 bits (263), Expect = 1.686e-22
Identity = 61/119 (51.26%), Postives = 75/119 (63.03%), Query Frame = 2
Query:   71 GANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASAS 427
            G N+LADG ++G GLG EIIGT  LV  V + TD +R  RD  +   APL IG +V + HL  I  TG GINPARS G+AVI      + + WIFWVGPFIG A+A   + FIL   +S
Sbjct:  125 GRNDLADGVNSGQGLGIEIIGTLQLVLCVLATTDRRR--RD--LGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHN---FSNHWIFWVGPFIGGALAVLIYDFILAPRSS 236          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP1_PIG (Aquaporin-1 OS=Sus scrofa GN=AQP1 PE=2 SV=3)

HSP 1 Score: 105.916 bits (263), Expect = 1.686e-22
Identity = 59/119 (49.58%), Postives = 70/119 (58.82%), Query Frame = 2
Query:   71 GANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASAS 427
            G N LA G  +G GLG EIIGT  LV  V + TD +R          APL IGF+V + HL  I  TG GINPARS G+AVI      + D W+FWVGPFIG A+A   + FIL   +S
Sbjct:  127 GLNSLAPGVDSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGS----APLAIGFSVALGHLLAIDYTGCGINPARSFGSAVITHN---FQDHWVFWVGPFIGGALAVLIYDFILAPRSS 238          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP1_BOVIN (Aquaporin-1 OS=Bos taurus GN=AQP1 PE=1 SV=3)

HSP 1 Score: 105.145 bits (261), Expect = 2.875e-22
Identity = 59/119 (49.58%), Postives = 71/119 (59.66%), Query Frame = 2
Query:   71 GANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASAS 427
            G N LA G ++G GLG EIIGT  LV  V + TD +R           PL IGF+V + HL  I  TG GINPARS G++VI      + D WIFWVGPFIGAA+A   + FIL   +S
Sbjct:  127 GLNALAPGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGS----GPLAIGFSVALGHLLAIDYTGCGINPARSFGSSVITHN---FQDHWIFWVGPFIGAALAVLIYDFILAPRSS 238          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP1_CANFA (Aquaporin-1 OS=Canis familiaris GN=AQP1 PE=2 SV=3)

HSP 1 Score: 103.99 bits (258), Expect = 6.405e-22
Identity = 61/119 (51.26%), Postives = 73/119 (61.34%), Query Frame = 2
Query:   71 GANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASAS 427
            G NELA G ++G GLG EIIGT  LV  V + TD +R  RD  +    PL IG +V + HL  I  TG GINPARS G++VI    K   D WIFWVGPFIG A+A   + FIL   +S
Sbjct:  127 GRNELAPGVNSGQGLGIEIIGTLQLVLCVLATTDRRR--RD--LGGSGPLAIGLSVALGHLLAIDYTGCGINPARSFGSSVITHNFK---DHWIFWVGPFIGGALAVLIYDFILAPRSS 238          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP1_RAT (Aquaporin-1 OS=Rattus norvegicus GN=Aqp1 PE=2 SV=4)

HSP 1 Score: 103.219 bits (256), Expect = 1.093e-21
Identity = 57/119 (47.90%), Postives = 73/119 (61.34%), Query Frame = 2
Query:   71 GANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASAS 427
            G N+LA G ++G GLG EIIGT  LV  V + TD +R          APL IG +V + HL  I  TG GINPARS G+AV+    + + + WIFWVGPFIG+A+A   + FIL   +S
Sbjct:  125 GRNDLARGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGS----APLAIGLSVALGHLLAIDYTGCGINPARSFGSAVL---TRNFSNHWIFWVGPFIGSALAVLIYDFILAPRSS 236          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP1_MOUSE (Aquaporin-1 OS=Mus musculus GN=Aqp1 PE=1 SV=3)

HSP 1 Score: 103.219 bits (256), Expect = 1.093e-21
Identity = 57/119 (47.90%), Postives = 72/119 (60.50%), Query Frame = 2
Query:   71 GANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASAS 427
            G N+LA G ++G GLG EIIGT  LV  V + TD +R          APL IG +V + HL  I  TG GINPARS G+AV+    + + + WIFWVGPFIG A+A   + FIL   +S
Sbjct:  125 GRNDLAHGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGS----APLAIGLSVALGHLLAIDYTGCGINPARSFGSAVL---TRNFSNHWIFWVGPFIGGALAVLIYDFILAPRSS 236          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPA_RANES (Aquaporin FA-CHIP OS=Rana esculenta GN=AQPA PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.336e-19
Identity = 58/130 (44.62%), Postives = 71/130 (54.62%), Query Frame = 2
Query:   71 GANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKALGSFKSSSN 460
            G N L+ G S G GLG EI+ TF LV  V + TD +R+     VP    L IG +V + HL  I  TG G+NPARS G+AV+    K +   WIFWVGP IG A AA  + FIL    S      K  +N
Sbjct:  129 GLNGLSPGVSAGQGLGVEILVTFQLVLCVVAVTDRRRHDVSGSVP----LAIGLSVALGHLIAIDYTGCGMNPARSFGSAVL---TKNFTYHWIFWVGPMIGGAAAAIIYDFILAPRTSDLTDRMKVWTN 251          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP4_RAT (Aquaporin-4 OS=Rattus norvegicus GN=Aqp4 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.633e-17
Identity = 53/136 (38.97%), Postives = 74/136 (54.41%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFI 409
            LGAI G G++           G G   +    + G GL  E+I TF LV+T+F++ D KR    + V     L IGF+V + HL  I  TG  +NPARS G AVI      W++ WI+WVGP IGA +A   ++++
Sbjct:  124 LGAIIGAGILYLVTPPSVVG-GLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASCDSKR----TDVTGSVALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGN---WENHWIYWVGPIIGAVLAGALYEYV 251          
The following BLAST results are available for this feature:
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 134
Match NameE-valueIdentityDescription
AQP1_HUMAN7.567e-2346.48Aquaporin-1 OS=Homo sapiens GN=AQP1 PE=1 SV=3[more]
AQP1_SHEEP1.686e-2251.26Aquaporin-1 OS=Ovis aries GN=AQP1 PE=2 SV=3[more]
AQP1_PONAB1.686e-2251.26Aquaporin-1 OS=Pongo abelii GN=AQP1 PE=2 SV=3[more]
AQP1_PIG1.686e-2249.58Aquaporin-1 OS=Sus scrofa GN=AQP1 PE=2 SV=3[more]
AQP1_BOVIN2.875e-2249.58Aquaporin-1 OS=Bos taurus GN=AQP1 PE=1 SV=3[more]
AQP1_CANFA6.405e-2251.26Aquaporin-1 OS=Canis familiaris GN=AQP1 PE=2 SV=3[more]
AQP1_RAT1.093e-2147.90Aquaporin-1 OS=Rattus norvegicus GN=Aqp1 PE=2 SV=4[more]
AQP1_MOUSE1.093e-2147.90Aquaporin-1 OS=Mus musculus GN=Aqp1 PE=1 SV=3[more]
AQPA_RANES1.336e-1944.62Aquaporin FA-CHIP OS=Rana esculenta GN=AQPA PE=2 S... [more]
AQP4_RAT1.633e-1738.97Aquaporin-4 OS=Rattus norvegicus GN=Aqp4 PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00446 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00446 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623355 ID=BQ623355|Name=BQ623355|organism=Citrus sinensis|type=EST|length=619bp
TTTGGGAGCCATATGTGGCTGCGGGCTCGTTAAGGCTTTCCAGAAGTCTT
ACTACACGAGATACGGCGGTGGAGCCAATGAGCTCGCTGATGGGTACAGC
ACTGGCACTGGATTGGGTGCTGAGATCATCGGTACCTTTGTTCTTGTCTA
CACTGTTTTCTCCGCCACTGATCCCAAGAGAAATGCTAGGGACTCCCACG
TTCCCGTCTTGGCGCCATTGCCAATTGGATTTGCTGTGTTCATGGTTCAC
TTGGCTACGATCCCTGTCACTGGAACTGGCATCAACCCCGCTAGAAGTTT
GGGAGCTGCAGTGATTTACAGCAAGGAGAAGGCTTGGGATGATCAATGGA
TCTTCTGGGTTGGCCCCTTCATTGGTGCTGCAATTGCTGCATTTTACCAC
CAATTCATCCTCAGAGCATCTGCTTCTAAAGCTCTTGGATCCTTCAAAAG
CTCCTCCAACATTTAATTAACTTTTAAAATAATTACTGGAGGATTAATCA
ATGGCTGTCAAGCGGCTTCGCGACTATGGAATTTGTACATTGTTTTATTT
GCATCAGTATTTAGTATAGCTGGTGTAGATCCCGCAGCACTTTGTGTGTG
TCTTTTGTTTACCTGAGGA
back to top