BQ623355

Overview
NameBQ623355
Unique NameBQ623355
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length619
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4610 contig Csv1_Contig4610:525..1143. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP4_NOTAL (Aquaporin-4 OS=Notomys alexis GN=AQP4 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.132e-17
Identity = 53/136 (38.97%), Postives = 74/136 (54.41%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFI 409
            LGAI G G++           G G   +    + G GL  E+I TF LV+T+F++ D KR    + V     L IGF+V + HL  I  TG  +NPARS G AVI      W++ WI+WVGP IGA +A   ++++
Sbjct:  127 LGAIIGAGILYLVTPPNVVG-GLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASCDSKR----TDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGN---WENHWIYWVGPIIGAVLAGALYEYV 254          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP_HAEIX (Aquaporin OS=Haematobia irritans exigua PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.785e-17
Identity = 45/138 (32.61%), Postives = 73/138 (52.90%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILR 415
            +GAI G  ++K       +    G +  +   + G  +  E + TF+LV  V   +DP R    + +   APL +G ++   HL  I +TG  +NPARS G AV+   +  W D W++WVGP +GA +AA  ++F+ +
Sbjct:  108 VGAIAGAAVIKVGVSEAVSGLDLGVSSFSSTLTVGQAVLIEALITFILVVVVKGVSDPGR----TDIKGSAPLAVGLSIAAGHLCAIKLTGASMNPARSFGPAVV---QNMWIDHWVYWVGPIVGAIVAALLYKFVFK 238          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP4_DIPME (Aquaporin-4 OS=Dipodomys merriami GN=AQP4 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.785e-17
Identity = 53/136 (38.97%), Postives = 74/136 (54.41%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFI 409
            LGAI G G++           G G   +    + G GL  E+I TF LV+T+F++ D KR    + V     L IGF+V + HL  I  TG  +NPARS G AVI      W++ WI+WVGP IGA +A   ++++
Sbjct:  124 LGAIIGAGILYLVTPPSVVG-GLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASCDSKR----TDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGN---WENHWIYWVGPIIGAVLAGGLYEYV 251          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP_ANOGA (Aquaporin AQPAn.G OS=Anopheles gambiae GN=AGAP008842 PE=3 SV=4)

HSP 1 Score: 88.1965 bits (217), Expect = 3.637e-17
Identity = 54/136 (39.71%), Postives = 73/136 (53.68%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIA-AFYHQF 406
            +GAI G  ++KA   S     G G   +A G STG G+  E + TF+LV+ V    D +R    + V   APL IG ++   HLA I  TG  +NPARS G AV+      + D W++WVGP +G  +A A Y  F
Sbjct:  108 IGAIAGAAVIKAATPSEVVG-GLGVTGIAPGLSTGQGVLIEALITFMLVFVVHGVCDNRR----TDVKGSAPLAIGLSITAGHLAAIKYTGASMNPARSFGPAVVMGN---YTDLWVYWVGPIVGGIVAGAVYRLF 235          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP4_HUMAN (Aquaporin-4 OS=Homo sapiens GN=AQP4 PE=1 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 3.637e-17
Identity = 53/136 (38.97%), Postives = 74/136 (54.41%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFI 409
            LGAI G G++           G G   +    + G GL  E+I TF LV+T+F++ D KR    + V     L IGF+V + HL  I  TG  +NPARS G AVI      W++ WI+WVGP IGA +A   ++++
Sbjct:  124 LGAIIGAGILYLVTPPSVVG-GLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDSKR----TDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGN---WENHWIYWVGPIIGAVLAGGLYEYV 251          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP4_BOVIN (Aquaporin-4 OS=Bos taurus GN=AQP4 PE=2 SV=3)

HSP 1 Score: 87.4261 bits (215), Expect = 6.204e-17
Identity = 53/136 (38.97%), Postives = 73/136 (53.68%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFI 409
            LGAI G G++           G G   +    S G GL  E+I TF LV+T+F++ D KR    + V     L IG +V + HL  I  TG  +NPARS G AVI      W++ WI+WVGP IGA +A   ++++
Sbjct:  124 LGAIIGAGILYLVTPPSVVG-GLGVTTVHGNLSAGHGLLVELIITFQLVFTIFASCDSKR----TDVTGSIALAIGISVAIGHLFAINYTGASMNPARSFGPAVIMGN---WENHWIYWVGPIIGAVLAGGLYEYV 251          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP_AEDAE (Aquaporin AQPAe.a OS=Aedes aegypti GN=AAEL003512 PE=2 SV=2)

HSP 1 Score: 86.2705 bits (212), Expect = 1.382e-16
Identity = 52/136 (38.24%), Postives = 71/136 (52.21%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIA-AFYHQF 406
            +GAI G  L+KA   S     G G   +    + G G+  E + TF+LV+ V    D +R    S +   APL IG ++   HL+ I  TG  +NPARS G AV+      W DQW++WVGP +G  +A A Y  F
Sbjct:  109 VGAIAGAALIKAATPSDVIG-GLGVTGIDPRLTAGQGVMIEALITFILVFVVHGVCDNRR----SDIKGSAPLAIGLSITAGHLSAIKYTGASMNPARSFGPAVVMGN---WTDQWVYWVGPIVGGILAGAVYRLF 236          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP4_MOUSE (Aquaporin-4 OS=Mus musculus GN=Aqp4 PE=2 SV=2)

HSP 1 Score: 86.2705 bits (212), Expect = 1.382e-16
Identity = 52/136 (38.24%), Postives = 73/136 (53.68%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFI 409
            LGAI G G++           G G   +    + G GL  E+I TF LV+T+F++ D KR    + V     L IGF+V + HL  I  TG  +NPARS G AVI      W + WI+WVGP +GA +A   ++++
Sbjct:  124 LGAIIGAGILYLVTPPSVVG-GLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASCDSKR----TDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGN---WANHWIYWVGPIMGAVLAGALYEYV 251          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP5_SHEEP (Aquaporin-5 OS=Ovis aries GN=AQP5 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.079e-16
Identity = 55/138 (39.86%), Postives = 76/138 (55.07%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAP-LPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            +GAI G  ++      Y  R     N L +  + G  + AE+I TF L   VFS+TD +R +     PV +P L IG +V + HL  I  TG  +NPARS G AVI S+  +    W+FWVGP +GAA AA  + ++L
Sbjct:   96 VGAIAGAAILYGLAP-YNARSNLAVNALNNNTTAGQAVVAEMILTFQLALCVFSSTDSRRTS-----PVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVIMSRFSS--AHWVFWVGPIVGAATAAIIYFYLL 225          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP32_ARATH (Probable aquaporin TIP3-2 OS=Arabidopsis thaliana GN=TIP3-2 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.021e-16
Identity = 49/117 (41.88%), Postives = 70/117 (59.83%), Query Frame = 2
Query:   83 LADGYSTGTGLGAEIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASK 430
            +A G S   GL  EII TF LVY V+S A DPKR +    + ++APL IG  V    L   P  G  +NPAR+ G A++  +   W + WI+WVGPFIG A+AA  +++++  S ++
Sbjct:  143 VASGVSELHGLLMEIILTFALVYVVYSTAIDPKRGS----IGIIAPLAIGLIVGANILVGGPFDGASMNPARAFGPALVGWR---WSNHWIYWVGPFIGGALAALIYEYMIIPSVNE 252          
The following BLAST results are available for this feature:
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 134
Match NameE-valueIdentityDescription
AQP4_NOTAL2.132e-1738.97Aquaporin-4 OS=Notomys alexis GN=AQP4 PE=2 SV=1[more]
AQP_HAEIX2.785e-1732.61Aquaporin OS=Haematobia irritans exigua PE=2 SV=1[more]
AQP4_DIPME2.785e-1738.97Aquaporin-4 OS=Dipodomys merriami GN=AQP4 PE=2 SV=... [more]
AQP_ANOGA3.637e-1739.71Aquaporin AQPAn.G OS=Anopheles gambiae GN=AGAP0088... [more]
AQP4_HUMAN3.637e-1738.97Aquaporin-4 OS=Homo sapiens GN=AQP4 PE=1 SV=2[more]
AQP4_BOVIN6.204e-1738.97Aquaporin-4 OS=Bos taurus GN=AQP4 PE=2 SV=3[more]
AQP_AEDAE1.382e-1638.24Aquaporin AQPAe.a OS=Aedes aegypti GN=AAEL003512 P... [more]
AQP4_MOUSE1.382e-1638.24Aquaporin-4 OS=Mus musculus GN=Aqp4 PE=2 SV=2[more]
AQP5_SHEEP3.079e-1639.86Aquaporin-5 OS=Ovis aries GN=AQP5 PE=2 SV=1[more]
TIP32_ARATH4.021e-1641.88Probable aquaporin TIP3-2 OS=Arabidopsis thaliana ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00446 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00446 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623355 ID=BQ623355|Name=BQ623355|organism=Citrus sinensis|type=EST|length=619bp
TTTGGGAGCCATATGTGGCTGCGGGCTCGTTAAGGCTTTCCAGAAGTCTT
ACTACACGAGATACGGCGGTGGAGCCAATGAGCTCGCTGATGGGTACAGC
ACTGGCACTGGATTGGGTGCTGAGATCATCGGTACCTTTGTTCTTGTCTA
CACTGTTTTCTCCGCCACTGATCCCAAGAGAAATGCTAGGGACTCCCACG
TTCCCGTCTTGGCGCCATTGCCAATTGGATTTGCTGTGTTCATGGTTCAC
TTGGCTACGATCCCTGTCACTGGAACTGGCATCAACCCCGCTAGAAGTTT
GGGAGCTGCAGTGATTTACAGCAAGGAGAAGGCTTGGGATGATCAATGGA
TCTTCTGGGTTGGCCCCTTCATTGGTGCTGCAATTGCTGCATTTTACCAC
CAATTCATCCTCAGAGCATCTGCTTCTAAAGCTCTTGGATCCTTCAAAAG
CTCCTCCAACATTTAATTAACTTTTAAAATAATTACTGGAGGATTAATCA
ATGGCTGTCAAGCGGCTTCGCGACTATGGAATTTGTACATTGTTTTATTT
GCATCAGTATTTAGTATAGCTGGTGTAGATCCCGCAGCACTTTGTGTGTG
TCTTTTGTTTACCTGAGGA
back to top