BQ623355

Overview
NameBQ623355
Unique NameBQ623355
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length619
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4610 contig Csv1_Contig4610:525..1143. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP1_TOBAC (Probable aquaporin TIP-type RB7-5A OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.162e-13
Identity = 50/134 (37.31%), Postives = 69/134 (51.49%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYH 400
            LG+   C L+K           G    +A G +   G+  EII TF LVYTV++ A DPK+ +    +  +AP+ IGF V    LA  P +G  +NPARS G AV+      +   WI+W GP IG  +A F +
Sbjct:  110 LGSTVACLLLKYVTNGLAVPTHG----VAAGLNGLQGVVMEIIITFALVYTVYATAADPKKGS----LGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVAGD---FSQNWIYWAGPLIGGGLAGFIY 232          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ_BRUSU (Aquaporin Z OS=Brucella suis GN=aqpZ PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 5.435e-13
Identity = 44/115 (38.26%), Postives = 61/115 (53.04%), Query Frame = 2
Query:   71 GANELADG-YSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            G  EL+ G YS   GL  EII T   +  +  +T     A        AP+ IGF + ++HL +IPVT T +NPARS G A +++   A    W+FWV P +GA I A   + +L
Sbjct:  118 GYGELSPGGYSMMAGLLIEIILTAFFIIIILGSTSSLAPAG------FAPIAIGFGLTLIHLVSIPVTNTSVNPARSTGVA-LFADTAALSQLWLFWVAPLVGAVIGAIIWKGLL 225          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ_BRUME (Aquaporin Z OS=Brucella melitensis GN=aqpZ PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 5.435e-13
Identity = 50/143 (34.97%), Postives = 71/143 (49.65%), Query Frame = 2
Query:    2 LGAICGCGL--VKAFQKSYYTRYGGGANELAD----GYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            LGAI    +  V A  K  ++  G  +N   +    GYS   GL  EII T   +  +  +T     A        AP+ IGF + ++HL +IPVT T +NPARS G A +++   A    W+FWV P +GA I A   + +L
Sbjct:   90 LGAIAAAAILYVIASGKDGFSAGGLASNGYGELSPGGYSMMAGLLIEIILTAFFIIIILGSTSSLAPAG------FAPIAIGFGLTLIHLVSIPVTNTWVNPARSTGVA-LFADTAALSQLWLFWVAPLVGAVIGAIIWKGLL 225          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQP6_HUMAN (Aquaporin-6 OS=Homo sapiens GN=AQP6 PE=2 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 5.435e-13
Identity = 41/114 (35.96%), Postives = 62/114 (54.39%), Query Frame = 2
Query:   71 GANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            G N + +  STG  +  E++ T  LV  VF++TD ++ +            IG +V + HL  I  TG  +NPARS G A+I  K   +   W+FWVGP +GA +A+  + F+L
Sbjct:  131 GINVVRNSVSTGQAVAVELLLTLQLVLCVFASTDSRQTSGSPATM------IGISVALGHLIGIHFTGCSMNPARSFGPAIIIGK---FTVHWVFWVGPLMGALLASLIYNFVL 235          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP22_ARATH (Probable aquaporin TIP2-2 OS=Arabidopsis thaliana GN=TIP2-2 PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 7.099e-13
Identity = 45/118 (38.14%), Postives = 65/118 (55.08%), Query Frame = 2
Query:   83 LADGYSTGTGLGAEIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKA 433
            +A G     G+  EI+ TF LVYTV++ A DPK+ +    +  +AP+ IGF V    LA  P +G  +NPARS G AV+      +   WI+WVGP +G A+A   +  +   S + A
Sbjct:  133 VAAGLGAIEGVVMEIVVTFALVYTVYATAADPKKGS----LGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGD---FSQIWIYWVGPLVGGALAGLIYGDVFIGSYAPA 243          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: MIP_RABIT (Lens fiber major intrinsic protein OS=Oryctolagus cuniculus GN=MIP PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 7.099e-13
Identity = 44/137 (32.12%), Postives = 69/137 (50.36%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFIL 412
            LGA+ G  ++ +   +   R     N L  G S G     EI  T   V  +F+  D +RN R   V     L +GF++ + HL  +  TG G+NPARS   A++    + + + W++WVGP IG  +A+  + F+L
Sbjct:   95 LGAVAGAAVLYSVTPAA-VRGNLALNTLHPGVSLGQATTVEIFLTLQFVLCIFATYDERRNGRLGSVA----LAVGFSLTLGHLFGMYYTGAGMNPARSFAPAIL---TRNFTNHWVYWVGPIIGGGLASLLYDFLL 223          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: TIP21_ARATH (Aquaporin TIP2-1 OS=Arabidopsis thaliana GN=TIP2-1 PE=1 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 9.271e-13
Identity = 54/145 (37.24%), Postives = 75/145 (51.72%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGA---NELADGYSTGTGLGAEIIGTFVLVYTVFS-ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASA 424
            LG+   C L+K     Y T  GG A   + +A G  +  G+  EII TF LVYTV++ A DPK+ +    +  +APL IG  V    LA  P +G  +NPARS G AV       +   W++WVGP IG  +A   +  +   S+
Sbjct:  110 LGSTAACFLLK-----YVT--GGLAVPTHSVAAGLGSIEGVVMEIIITFALVYTVYATAADPKKGS----LGTIAPLAIGLIVGANILAAGPFSGGSMNPARSFGPAVAAGD---FSGHWVYWVGPLIGGGLAGLIYGNVFMGSS 240          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ_VIBVU (Aquaporin Z OS=Vibrio vulnificus GN=aqpZ PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 9.271e-13
Identity = 38/106 (35.85%), Postives = 58/106 (54.72%), Query Frame = 2
Query:   92 GYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFI 409
            GYS  + L  E++ T + +  +  ATD +           AP+ IG  + ++HL +IPVT T +NPARS G A +Y  + A    W+FWV P +GA + A  ++ I
Sbjct:  127 GYSLTSALVTEVVMTMMFLLVILGATDQRAPQG------FAPIAIGLCLTLIHLISIPVTNTSVNPARSTGVA-LYVGDWATAQLWLFWVAPILGALLGAVAYKLI 225          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ_BORPA (Aquaporin Z OS=Bordetella parapertussis GN=aqpZ PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 9.271e-13
Identity = 40/112 (35.71%), Postives = 61/112 (54.46%), Query Frame = 2
Query:   95 YSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASK 430
            YS    L  EI+ +   V+ +  ATD +  A        AP+PIG A+ ++HL +IPVT T +NPARS G A ++    A +  W+FW+ P  GA + A  ++ +   SA +
Sbjct:  132 YSMQAALICEIVLSAGFVFVILGATDKRAPAG------FAPIPIGLALTLIHLISIPVTNTSVNPARSTGPA-LFVGGWALEQLWLFWLAPIAGALVGALAYRLVGTPSAQR 236          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: AQPZ_BORBR (Aquaporin Z OS=Bordetella bronchiseptica GN=aqpZ PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 9.271e-13
Identity = 40/112 (35.71%), Postives = 61/112 (54.46%), Query Frame = 2
Query:   95 YSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASK 430
            YS    L  EI+ +   V+ +  ATD +  A        AP+PIG A+ ++HL +IPVT T +NPARS G A ++    A +  W+FW+ P  GA + A  ++ +   SA +
Sbjct:  132 YSMQAALICEIVLSAGFVFVILGATDKRAPAG------FAPIPIGLALTLIHLISIPVTNTSVNPARSTGPA-LFVGGWALEQLWLFWLAPIAGALVGALAYRLVGTPSAQR 236          
The following BLAST results are available for this feature:
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 134
Match NameE-valueIdentityDescription
TIP1_TOBAC4.162e-1337.31Probable aquaporin TIP-type RB7-5A OS=Nicotiana ta... [more]
AQPZ_BRUSU5.435e-1338.26Aquaporin Z OS=Brucella suis GN=aqpZ PE=3 SV=1[more]
AQPZ_BRUME5.435e-1334.97Aquaporin Z OS=Brucella melitensis GN=aqpZ PE=3 SV... [more]
AQP6_HUMAN5.435e-1335.96Aquaporin-6 OS=Homo sapiens GN=AQP6 PE=2 SV=2[more]
TIP22_ARATH7.099e-1338.14Probable aquaporin TIP2-2 OS=Arabidopsis thaliana ... [more]
MIP_RABIT7.099e-1332.12Lens fiber major intrinsic protein OS=Oryctolagus ... [more]
TIP21_ARATH9.271e-1337.24Aquaporin TIP2-1 OS=Arabidopsis thaliana GN=TIP2-1... [more]
AQPZ_VIBVU9.271e-1335.85Aquaporin Z OS=Vibrio vulnificus GN=aqpZ PE=3 SV=1[more]
AQPZ_BORPA9.271e-1335.71Aquaporin Z OS=Bordetella parapertussis GN=aqpZ PE... [more]
AQPZ_BORBR9.271e-1335.71Aquaporin Z OS=Bordetella bronchiseptica GN=aqpZ P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00446 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00446 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623355 ID=BQ623355|Name=BQ623355|organism=Citrus sinensis|type=EST|length=619bp
TTTGGGAGCCATATGTGGCTGCGGGCTCGTTAAGGCTTTCCAGAAGTCTT
ACTACACGAGATACGGCGGTGGAGCCAATGAGCTCGCTGATGGGTACAGC
ACTGGCACTGGATTGGGTGCTGAGATCATCGGTACCTTTGTTCTTGTCTA
CACTGTTTTCTCCGCCACTGATCCCAAGAGAAATGCTAGGGACTCCCACG
TTCCCGTCTTGGCGCCATTGCCAATTGGATTTGCTGTGTTCATGGTTCAC
TTGGCTACGATCCCTGTCACTGGAACTGGCATCAACCCCGCTAGAAGTTT
GGGAGCTGCAGTGATTTACAGCAAGGAGAAGGCTTGGGATGATCAATGGA
TCTTCTGGGTTGGCCCCTTCATTGGTGCTGCAATTGCTGCATTTTACCAC
CAATTCATCCTCAGAGCATCTGCTTCTAAAGCTCTTGGATCCTTCAAAAG
CTCCTCCAACATTTAATTAACTTTTAAAATAATTACTGGAGGATTAATCA
ATGGCTGTCAAGCGGCTTCGCGACTATGGAATTTGTACATTGTTTTATTT
GCATCAGTATTTAGTATAGCTGGTGTAGATCCCGCAGCACTTTGTGTGTG
TCTTTTGTTTACCTGAGGA
back to top