BQ623358

Overview
NameBQ623358
Unique NameBQ623358
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length651
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1053 contig Csv1_Contig1053:110..761. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_SCHPO (Nascent polypeptide-associated complex subunit beta OS=Schizosaccharomyces pombe GN=btf3 PE=2 SV=2)

HSP 1 Score: 106.301 bits (264), Expect = 1.428e-22
Identity = 60/148 (40.54%), Postives = 88/148 (59.46%), Query Frame = 3
Query:   24 MNVEKLMKMAGAVRTGGKGSVRRKKKAVHKT--TTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDDV-VIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 458
            M+  KL K+    R GGKG+ RRK K   K+  +  DDK++Q  LK++ +  +  I+EVN+FK+D  VI F  P V +S+   T  + G  + K L +ILPGI+N LGP++L  LR++AEQ +      G  A    + DD E+P+LV
Sbjct:    1 MDPSKLAKLQAGARIGGKGTPRRKVKKPSKSAMSAADDKKVQGALKKLNMQNLAGIQEVNMFKEDGGVINFRAPTVHSSLPNETTAIYGKAEEKTLSEILPGILNNLGPESLTALRQMAEQLKVSEGEKGADA----QADDGEIPDLV 144          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_DICDI (Nascent polypeptide-associated complex subunit beta OS=Dictyostelium discoideum GN=nacB PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.062e-21
Identity = 65/146 (44.52%), Postives = 92/146 (63.01%), Query Frame = 3
Query:   30 VEKLMKMAGA-VRTGGKGSVRRKKKAVHKTTTT-DDKRLQSTLKRIGVNAIPAIEEVNIFK-DDVVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 458
            + +L K+A   VRTGGKGS+RRK++  HK+TT+ DDK+L   L  +GV  I A+EE N FK D  +I F NP VQ   A+ T+V+SG  +TK +  I P +I QLG +NL+ ++K+A+ F   A NA T          D++P+LV
Sbjct:    5 IARLNKLAEERVRTGGKGSMRRKQQVTHKSTTSVDDKKLHVKLANLGVKPIGAVEEANFFKADGNIIHFKNPSVQT--ASKTFVISGKNETKPMASI-PHVIAQLGAENLNQIKKMADAF-SAAKNANT----------DDIPDLV 136          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_YARLI (Nascent polypeptide-associated complex subunit beta OS=Yarrowia lipolytica GN=EGD1 PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 5.999e-21
Identity = 59/154 (38.31%), Postives = 89/154 (57.79%), Query Frame = 3
Query:   12 PSSKMNVEKLMKMAGAVRTGGKGSVRRK-KKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDD-VVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQF---QKQAPNAGTGAPTTQEDDDDEVPELV 458
            P     +  L K +GA ++GGKG+ RR  KK   +  + D+K+L +TLK+     I  I EVN+FK+D  V+ F    V+ S+A+NT+ +SG  Q K + +++P I+ Q+G D L  L++ A QF   Q+QA     G    +E  DDE+P LV
Sbjct:    2 PVDPAKLAALQKKSGA-QSGGKGTPRRPGKKVAGRNISEDEKKLSATLKKFNAQEITGISEVNMFKEDGTVLHFPKVHVEGSVASNTFAISGPSQQKDIAELIPDILPQMGQDALLQLQQAAVQFSKLQEQAKKTAGGPDAAKEAGDDEIPNLV 154          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB1_YEAST (Nascent polypeptide-associated complex subunit beta-1 OS=Saccharomyces cerevisiae GN=EGD1 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 8.108e-18
Identity = 57/151 (37.75%), Postives = 76/151 (50.33%), Query Frame = 3
Query:   12 PSSKMNVEKLMKMAGAVRTGGKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDDVVIQFLNPKVQASIAA--NTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 458
            P  +  + KL K++   + GG      KK         DD +LQS L ++    I  + E N FKDD  +   N KV   +AA  NT V  G PQ K LQD+ PGII+QLGP+ +  L +LA Q +K        AP   E  D+ +PELV
Sbjct:    2 PIDQEKLAKLQKLSANNKVGGTRRKLNKKAGSSAGANKDDTKLQSQLAKLHAVTIDNVAEANFFKDDGKVMHFN-KVGVQVAAQHNTSVFYGLPQEKNLQDLFPGIISQLGPEAIQALSQLAAQMEKHEAK----APADAEKKDEAIPELV 147          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB1_YEAS7 (Nascent polypeptide-associated complex subunit beta-1 OS=Saccharomyces cerevisiae (strain YJM789) GN=EGD1 PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 8.108e-18
Identity = 57/151 (37.75%), Postives = 76/151 (50.33%), Query Frame = 3
Query:   12 PSSKMNVEKLMKMAGAVRTGGKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDDVVIQFLNPKVQASIAA--NTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 458
            P  +  + KL K++   + GG      KK         DD +LQS L ++    I  + E N FKDD  +   N KV   +AA  NT V  G PQ K LQD+ PGII+QLGP+ +  L +LA Q +K        AP   E  D+ +PELV
Sbjct:    2 PIDQEKLAKLQKLSANNKVGGTRRKLNKKAGSSAGANKDDTKLQSQLAKLHAVTIDNVAEANFFKDDGKVMHFN-KVGVQVAAQHNTSVFYGLPQEKNLQDLFPGIISQLGPEAIQALSQLAAQMEKHEAK----APADAEKKDEAIPELV 147          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_ASHGO (Nascent polypeptide-associated complex subunit beta OS=Ashbya gossypii GN=EGD1 PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 4.024e-17
Identity = 59/157 (37.58%), Postives = 84/157 (53.50%), Query Frame = 3
Query:   12 PSSKMNVEKLMKMAGAVRTGGKGSVRRK--KKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDD-VVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQ-----EDDDDEVPELV 458
            P  +  + KL K++   + GG    RRK  KK+   +   DD +LQ+ L ++    +  +EE N FKDD  V+ F    VQ +   NT V  G PQ K LQD+ P II QLG +++D L +LA Q Q    NA   AP T+     E  D+++PEL+
Sbjct:    2 PIDQEKLAKLQKLSANNKVGG---TRRKLAKKSGTASANKDDSKLQAQLAKLKAVTMDQVEEANFFKDDGSVLHFNKVGVQVAPQHNTSVFYGIPQEKSLQDLFPSIIPQLGSESIDALTQLATQLQ----NAQAAAPATEGHEAGEKKDNDIPELI 151          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_LODEL (Nascent polypeptide-associated complex subunit beta OS=Lodderomyces elongisporus GN=EGD1 PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.449e-16
Identity = 56/146 (38.36%), Postives = 81/146 (55.48%), Query Frame = 3
Query:   33 EKLMKMAGAVRTGGKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDD-VVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQ--KQAPNAG-TGAPTTQEDDDDEVPELV 458
            EKL K+  +      GS  + KK V   T  DD +L  TL ++    I  +EE N FKDD  V+ F    VQ + AANT+  +G PQ K +  ++P I+ QLG +NL+ LR+LAEQ Q  K   + G  G     E+ ++++P+LV
Sbjct:    6 EKLAKLQKSTAKKVGGSRVKAKKGVK--TEQDDTKLIETLGKLKATKIEGVEEANFFKDDGKVLHFNRVGVQGAPAANTFAFTGYPQEKNITQLIPQILPQLGAENLEILRQLAEQIQAGKNPKDFGAAGEAGATEEANEDIPDLV 149          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_CANGA (Nascent polypeptide-associated complex subunit beta OS=Candida glabrata GN=EGD1 PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 4.919e-15
Identity = 52/150 (34.67%), Postives = 73/150 (48.67%), Query Frame = 3
Query:   12 PSSKMNVEKLMKMAGAVRTGGKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDD-VVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELV 458
            P  +  + KL KM+   + GG    + KK         DD +L + L ++    I  + E N FKDD  V+ F    VQ +   NT V  G  Q K LQ++ PGII+QLG + +  L +LA Q +K   N   G     E  D+ +PELV
Sbjct:    2 PIDQEKLAKLQKMSAGNKVGGTRRKQAKKTGSGSAGNKDDTKLHNQLAKLHAVTIDNVAEANFFKDDGKVLHFNKVGVQVAPQHNTSVFYGMAQEKNLQELFPGIISQLGGEAIQALSQLAAQMEKAQANENAG-----EAKDEAIPELV 146          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_KLULA (Nascent polypeptide-associated complex subunit beta OS=Kluyveromyces lactis GN=EGD1 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 6.425e-15
Identity = 52/151 (34.44%), Postives = 79/151 (52.32%), Query Frame = 3
Query:   12 PSSKMNVEKLMKMAGAVRTGGKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDD-VVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQK-QAPNAGTGAPTTQEDDDDEVPELV 458
            P  +  + KL K++   + GG    RRK      +++ DD +LQ  L+++    +  +++ N FKDD  V+ F    VQ +   NT V  G PQ K LQ++ P II Q+G D ++ L ++A Q Q  Q  N    AP   E  D ++PELV
Sbjct:    2 PIDQEKLAKLQKLSANNKVGG---TRRKFAKKSGSSSKDDSKLQDQLQKLRAVTVDNVQQANFFKDDGTVLHFNKVGVQVAPQHNTSVFYGIPQEKSLQELFPDIIPQMGADAINALTQMASQLQSAQGANQQAAAPEA-EGKDIDIPELV 148          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_PICST (Nascent polypeptide-associated complex subunit beta OS=Pichia stipitis GN=EGD1 PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.431e-14
Identity = 53/145 (36.55%), Postives = 77/145 (53.10%), Query Frame = 3
Query:   33 EKLMKMAGAVRTGGKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDD-VVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQ--KQAPNAGTGAPTTQEDDDDEVPELV 458
            EKL K+  A      GS  + KK V   T  DD +L   L ++    I  +EE N F++D  V+ F    VQ + A+NT+  +G PQ K +  ++P I+ QLG +NL+ LR+LAEQ Q  K       GAP      D+ +P+L+
Sbjct:    6 EKLAKLQKAAAKKVGGSRVKAKKVVK--TEQDDTKLIEALGKLKATKIENVEEANFFREDGKVLHFNRVGVQGAAASNTFAFTGYPQEKNVTQLIPQILPQLGAENLEILRQLAEQLQAGKAPTELNAGAPA---GGDEGIPDLI 145          
The following BLAST results are available for this feature:
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 43
Match NameE-valueIdentityDescription
NACB_SCHPO1.428e-2240.54Nascent polypeptide-associated complex subunit bet... [more]
NACB_DICDI2.062e-2144.52Nascent polypeptide-associated complex subunit bet... [more]
NACB_YARLI5.999e-2138.31Nascent polypeptide-associated complex subunit bet... [more]
NACB1_YEAST8.108e-1837.75Nascent polypeptide-associated complex subunit bet... [more]
NACB1_YEAS78.108e-1837.75Nascent polypeptide-associated complex subunit bet... [more]
NACB_ASHGO4.024e-1737.58Nascent polypeptide-associated complex subunit bet... [more]
NACB_LODEL4.449e-1638.36Nascent polypeptide-associated complex subunit bet... [more]
NACB_CANGA4.919e-1534.67Nascent polypeptide-associated complex subunit bet... [more]
NACB_KLULA6.425e-1534.44Nascent polypeptide-associated complex subunit bet... [more]
NACB_PICST1.431e-1436.55Nascent polypeptide-associated complex subunit bet... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00449 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00449 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623358 ID=BQ623358|Name=BQ623358|organism=Citrus sinensis|type=EST|length=651bp
CACACAAAAACCCTAGCTCCAAGATGAATGTGGAGAAGCTAATGAAGATG
GCCGGTGCAGTTCGCACCGGTGGTAAGGGTAGTGTGAGAAGAAAGAAGAA
GGCTGTTCATAAGACAACAACCACCGATGACAAGAGGCTTCAGAGCACCT
TGAAGAGAATAGGAGTGAATGCTATTCCTGCAATTGAGGAAGTTAACATT
TTCAAGGATGACGTCGTTATTCAGTTCTTAAATCCCAAAGTACAAGCTTC
AATTGCTGCCAACACATGGGTAGTTAGTGGTGCCCCACAAACCAAGAAGT
TGCAGGATATTCTCCCTGGAATTATCAATCAATTGGGGCCAGATAATTTG
GACAACCTGAGGAAGTTGGCGGAGCAGTTTCAGAAGCAAGCACCTAATGC
AGGAACTGGTGCACCCACGACTCAAGAGGACGACGACGATGAGGTCCCAG
AGCTTGTGGCAGGCGAGACGTTTGAAGCTGCCGCAGAGGAGAAAACAGAG
AAACCTGACGCTGCTTCTTAGAGAGTTTTATCTAGAGGGACTTTGGGTAT
TCTATATATTTTCTATGTTTTTTGAGTTTTTATTTTACTTTTCCGAGTCA
ACTTTCTCTTGTTTTATCTGATTCTCCCTGTGACACTAGATATTGGTACT
T
back to top