BQ623358

Overview
NameBQ623358
Unique NameBQ623358
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length651
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1053 contig Csv1_Contig1053:110..761. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_DEBHA (Nascent polypeptide-associated complex subunit beta OS=Debaryomyces hansenii GN=EGD1 PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.869e-14
Identity = 53/151 (35.10%), Postives = 77/151 (50.99%), Query Frame = 3
Query:   12 PSSKMNVEKLMKMAGAVRTGGKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDD-VVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQK-QAPNAGTGAPTTQEDDDDEVPELV 458
            P     + KL K + A + GG     R K   +  T  DD +L   L ++    I  IEE N FK+D  V+ F    VQ +   NT+ ++G PQ K +  ++P I+ QLG +NL+ LRKLAEQ Q  + P    G     E+D   +P+L+
Sbjct:    2 PVDPEKLAKLQKASVAKKVGGS----RVKAKKNVKTEQDDTKLIEALGKLKAQKIEGIEEANFFKEDGKVLHFNRVGVQGAAQHNTFALTGYPQEKDVTQLIPQILPQLGAENLEILRKLAEQIQAGKNPELNAGGAEGAEED---IPDLI 145          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_CANAL (Nascent polypeptide-associated complex subunit beta OS=Candida albicans GN=EGD1 PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 9.277e-14
Identity = 52/148 (35.14%), Postives = 80/148 (54.05%), Query Frame = 3
Query:   33 EKLMKM--AGAVRTGGKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDD-VVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQ--KQAPNAGTGAPTTQED-DDDEVPELV 458
            EKL K+  + A + GG     R K   +  T  DD +L   L ++    I  +EE N F++D  V+ F    VQ + A+NT+  +G PQ K +  ++P I+ QLG +NL+ LR+LAEQ Q  K   +  TG+     D   +++P+LV
Sbjct:    6 EKLAKLQKSSAKKVGGS----RVKAKKNIKTEQDDTKLIEALGKLKATKIEGVEEANFFREDGKVLHFNRVGVQGAPASNTFAFTGYPQEKNITQLIPQILPQLGAENLEILRQLAEQIQAGKTPKDFNTGSANAAADAGGEDIPDLV 149          
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Match: NACB_PICGU (Nascent polypeptide-associated complex subunit beta OS=Pichia guilliermondii GN=EGD1 PE=3 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 2.285e-12
Identity = 49/145 (33.79%), Postives = 77/145 (53.10%), Query Frame = 3
Query:   33 EKLMKMA-GAVRTGGKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDD-VVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQK-QAPNAGTGAPTTQEDDDDEVPELV 458
            EKL K+  GA +  G   V+ KK    +    DD +L   L ++    + A+EE N FK+D  V+ F    VQ++   N    +G PQ K +  ++P I+ QLG +NL+ LR+LAEQ Q  + P+ G          D+++P+L+
Sbjct:    6 EKLAKLQQGAAKKVGGQRVKAKKVKSEQ----DDTKLMEALGKLKATKVNAVEEANFFKEDGKVLHFKRVGVQSAAQHNVCAFTGYPQEKDVTQLIPQILPQLGAENLEILRQLAEQIQAGKTPSMG----GENAGADEDIPDLI 142          
The following BLAST results are available for this feature:
BLAST of BQ623358 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 43
Match NameE-valueIdentityDescription
NACB_DEBHA1.869e-1435.10Nascent polypeptide-associated complex subunit bet... [more]
NACB_CANAL9.277e-1435.14Nascent polypeptide-associated complex subunit bet... [more]
NACB_PICGU2.285e-1233.79Nascent polypeptide-associated complex subunit bet... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00449 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00449 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623358 ID=BQ623358|Name=BQ623358|organism=Citrus sinensis|type=EST|length=651bp
CACACAAAAACCCTAGCTCCAAGATGAATGTGGAGAAGCTAATGAAGATG
GCCGGTGCAGTTCGCACCGGTGGTAAGGGTAGTGTGAGAAGAAAGAAGAA
GGCTGTTCATAAGACAACAACCACCGATGACAAGAGGCTTCAGAGCACCT
TGAAGAGAATAGGAGTGAATGCTATTCCTGCAATTGAGGAAGTTAACATT
TTCAAGGATGACGTCGTTATTCAGTTCTTAAATCCCAAAGTACAAGCTTC
AATTGCTGCCAACACATGGGTAGTTAGTGGTGCCCCACAAACCAAGAAGT
TGCAGGATATTCTCCCTGGAATTATCAATCAATTGGGGCCAGATAATTTG
GACAACCTGAGGAAGTTGGCGGAGCAGTTTCAGAAGCAAGCACCTAATGC
AGGAACTGGTGCACCCACGACTCAAGAGGACGACGACGATGAGGTCCCAG
AGCTTGTGGCAGGCGAGACGTTTGAAGCTGCCGCAGAGGAGAAAACAGAG
AAACCTGACGCTGCTTCTTAGAGAGTTTTATCTAGAGGGACTTTGGGTAT
TCTATATATTTTCTATGTTTTTTGAGTTTTTATTTTACTTTTCCGAGTCA
ACTTTCTCTTGTTTTATCTGATTCTCCCTGTGACACTAGATATTGGTACT
T
back to top