BQ623378
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of BQ623378 vs. ExPASy Swiss-Prot
Match: CB4A_ARATH (Chlorophyll a-b binding protein CP29.1, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.1 PE=1 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 9.600e-14 Identity = 36/58 (62.07%), Postives = 44/58 (75.86%), Query Frame = 2 Query: 23 FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVN 196 FDPLGLA DPE A+L++ EIK+ RLAM + GF VQA TGKGPL N A HL+DP++ Sbjct: 223 FDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLH 280
BLAST of BQ623378 vs. ExPASy Swiss-Prot
Match: CB4B_ARATH (Chlorophyll a-b binding protein CP29.2, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.2 PE=1 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 6.223e-13 Identity = 35/58 (60.34%), Postives = 42/58 (72.41%), Query Frame = 2 Query: 23 FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVN 196 FDPLGLA DP A+L++ EIK+ RLAM GF VQA TGKGPL N A HL+DP++ Sbjct: 220 FDPLGLASDPVKKAQLQLAEIKHARLAMVGFLGFAVQAAATGKGPLNNWATHLSDPLH 277 The following BLAST results are available for this feature:
BLAST of BQ623378 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 72
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623378 ID=BQ623378; Name=BQ623378; organism=Citrus sinensis; type=EST; length=349bpback to top |