BQ623594

Overview
NameBQ623594
Unique NameBQ623594
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length427
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2221 contig Csv1_Contig2221:826..1252. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: APK1B_ARATH (Protein kinase APK1B, chloroplastic OS=Arabidopsis thaliana GN=APK1B PE=2 SV=2)

HSP 1 Score: 114.005 bits (284), Expect = 2.440e-25
Identity = 60/138 (43.48%), Postives = 84/138 (60.87%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKL-SEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYE 416
            +I+RD K+SN+L+  +  AK++DF L+   P       STR++GT+GY APEY  TG L  KSDVYS+GVVLLE+L+GR+ VD   P G+Q LV WA P L ++ K+ + +D RL   Y              C+ +E
Sbjct:  200 VIYRDFKTSNILLDSEYNAKLSDFGLAKDGPTGDKSHVSTRIMGTYGYAAPEYLATGHLTTKSDVYSYGVVLLEVLSGRRAVDKNRPPGEQKLVEWARPLLANKRKLFRVIDNRLQDQYSMEEACKVATLALRCLTFE 337          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: APK1A_ARATH (Protein kinase APK1A, chloroplastic OS=Arabidopsis thaliana GN=APK1A PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 2.440e-25
Identity = 60/119 (50.42%), Postives = 80/119 (67.23%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKL-SEDKVRQCVDARLGGDY 359
            +I+RD K+SN+L+  +  AK++DF L+   P       STRV+GT GY APEY  TG L  KSDVYSFGVVLLELL+GR+ VD   P G+++LV WA P L ++ K+ + +D RL   Y
Sbjct:  199 VIYRDFKTSNILLDSEYNAKLSDFGLAKDGPIGDKSHVSTRVMGTHGYAAPEYLATGHLTTKSDVYSFGVVLLELLSGRRAVDKNRPSGERNLVEWAKPYLVNKRKIFRVIDNRLQDQY 317          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y2296_ARATH (Probable receptor-like protein kinase At2g42960 OS=Arabidopsis thaliana GN=At2g42960 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 4.162e-25
Identity = 57/114 (50.00%), Postives = 78/114 (68.42%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARL 347
            ++HRDIK+SN+LI D+  AK++DF L+       + + +TRV+GTFGY APEYA TG LN KSD+YSFGV+LLE +TGR PVD+  P  + +LV W    +   +  + VD RL
Sbjct:  305 VVHRDIKASNILIDDEFNAKLSDFGLAKLLDSGESHI-TTRVMGTFGYVAPEYANTGLLNEKSDIYSFGVLLLEAITGRDPVDYGRPANEVNLVEWLKMMVGTRRAEEVVDPRL 417          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y1154_ARATH (Probable serine/threonine-protein kinase At1g01540 OS=Arabidopsis thaliana GN=At1g01540 PE=1 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 5.435e-25
Identity = 52/114 (45.61%), Postives = 81/114 (71.05%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARL 347
            ++HRDIKSSN+L+     AK++DF L+      ++ + +TRV+GTFGY APEYA TG LN KSD+YSFG++++E++TGR PVD++ P+G+ +LV W    +   +  + VD ++
Sbjct:  276 VVHRDIKSSNILLDRQWNAKVSDFGLAKLLGSESSYV-TTRVMGTFGYVAPEYACTGMLNEKSDIYSFGILIMEIITGRNPVDYSRPQGETNLVDWLKSMVGNRRSEEVVDPKI 388          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: NAK_ARATH (Probable serine/threonine-protein kinase NAK OS=Arabidopsis thaliana GN=NAK PE=2 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 5.435e-25
Identity = 61/120 (50.83%), Postives = 83/120 (69.17%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLH-STRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKL-SEDKVRQCVDARLGGDY 359
            +I+RD K+SN+L+  +  AK++DF L+   P M    H STRV+GT GY APEY  TG L+ KSDVYSFGVVLLELL+GR+ +D   P G+ +LV WA P L ++ ++ + +D RL G Y
Sbjct:  199 VIYRDFKASNILLDSNYNAKLSDFGLARDGP-MGDNSHVSTRVMGTQGYAAPEYLATGHLSVKSDVYSFGVVLLELLSGRRAIDKNQPVGEHNLVDWARPYLTNKRRLLRVMDPRLQGQY 317          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y2393_ARATH (Probable receptor-like protein kinase At2g39360 OS=Arabidopsis thaliana GN=At2g39360 PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 2.065e-24
Identity = 56/116 (48.28%), Postives = 77/116 (66.38%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGG 353
            IIHRD+KS+N+L+ D+ +AK+ADF LS   PD+     ST V G+FGY  PEY    QL  KSDVYSFGVV+LE++ GR  +D +LPR + +L+ WA   + + K+   +D  L G
Sbjct:  608 IIHRDVKSANILLDDNFMAKVADFGLSKTGPDLDQTHVSTAVKGSFGYLDPEYLTRQQLTEKSDVYSFGVVMLEVVCGRPVIDPSLPREKVNLIEWAMKLVKKGKLEDIIDPFLVG 723          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: NORK_PEA (Nodulation receptor kinase OS=Pisum sativum GN=NORK PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 2.697e-24
Identity = 58/118 (49.15%), Postives = 75/118 (63.56%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDY 359
            +IHRD+KSSN+L+     AK+ADF  S  AP       S  V GT GY  PEY  T QL+ KSDV+SFGVVLLE+++GR+P++   PR + SLV WA P +   KV + VD  + G Y
Sbjct:  717 VIHRDVKSSNILLDHSMCAKVADFGFSKYAPQEGDSYVSLEVRGTAGYLDPEYYKTQQLSEKSDVFSFGVVLLEIVSGREPLNIKRPRVEWSLVEWAKPYIRASKVDEIVDPGIKGGY 834          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: NORK_MEDTR (Nodulation receptor kinase OS=Medicago truncatula GN=NORK PE=1 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 2.697e-24
Identity = 58/118 (49.15%), Postives = 75/118 (63.56%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDY 359
            +IHRD+KSSN+L+     AK+ADF  S  AP       S  V GT GY  PEY  T QL+ KSDV+SFGVVLLE+++GR+P++   PR + SLV WA P +   KV + VD  + G Y
Sbjct:  718 VIHRDVKSSNILLDQSMCAKVADFGFSKYAPQEGDSYVSLEVRGTAGYLDPEYYKTQQLSEKSDVFSFGVVLLEIVSGREPLNIKRPRIEWSLVEWAKPYIRASKVDEIVDPGIKGGY 835          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: SRF7_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 7 OS=Arabidopsis thaliana GN=SRF7 PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 1.339e-23
Identity = 63/141 (44.68%), Postives = 85/141 (60.28%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSE-DKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEADF 425
            I+H++IKS+N+L+  +    ++D  L++  P     L+        GY APE +M+GQ + KSDVYSFGVV+LELLTGRKP D T  R +QSLV WATP+L + D + + VD  L G YP            LCVQ E +F
Sbjct:  543 IVHKNIKSANILLDSELNPHLSDSGLASFLPTANELLNQNDE----GYSAPETSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPEF 679          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CX32_ARATH (Probable serine/threonine-protein kinase Cx32, chloroplastic OS=Arabidopsis thaliana GN=At4g35600 PE=1 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 1.339e-23
Identity = 55/119 (46.22%), Postives = 80/119 (67.23%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLS-EDKVRQCVDARLGGDY 359
            +I+RD K+SN+L+  +  AK++DF L+   P       +TR++GT+GY APEY  TG L  KSDV++FGVVLLE++TG    +   PRGQ+SLV W  P+LS + +V+Q +D  + G Y
Sbjct:  214 VIYRDFKASNILLDSNYDAKLSDFGLAKLGPADEKSHVTTRIMGTYGYAAPEYMATGHLYVKSDVFAFGVVLLEIMTGLTAHNTKRPRGQESLVDWLRPELSNKHRVKQIMDKGIKGQY 332          
The following BLAST results are available for this feature:
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 246
Match NameE-valueIdentityDescription
APK1B_ARATH2.440e-2543.48Protein kinase APK1B, chloroplastic OS=Arabidopsis... [more]
APK1A_ARATH2.440e-2550.42Protein kinase APK1A, chloroplastic OS=Arabidopsis... [more]
Y2296_ARATH4.162e-2550.00Probable receptor-like protein kinase At2g42960 OS... [more]
Y1154_ARATH5.435e-2545.61Probable serine/threonine-protein kinase At1g01540... [more]
NAK_ARATH5.435e-2550.83Probable serine/threonine-protein kinase NAK OS=Ar... [more]
Y2393_ARATH2.065e-2448.28Probable receptor-like protein kinase At2g39360 OS... [more]
NORK_PEA2.697e-2449.15Nodulation receptor kinase OS=Pisum sativum GN=NOR... [more]
NORK_MEDTR2.697e-2449.15Nodulation receptor kinase OS=Medicago truncatula ... [more]
SRF7_ARATH1.339e-2344.68Protein STRUBBELIG-RECEPTOR FAMILY 7 OS=Arabidopsi... [more]
CX32_ARATH1.339e-2346.22Probable serine/threonine-protein kinase Cx32, chl... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00685 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00685 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623594 ID=BQ623594|Name=BQ623594|organism=Citrus sinensis|type=EST|length=427bp
CTCATATTATCCATCGCGATATTAAGTCCAGCAATGTACTAATTTTTGAT
GATGATGTAGCAAAGATTGCCGACTTTGATTTATCTAATCAAGCTCCTGA
TATGGCAGCTCGCCTTCATTCTACTCGTGTTCTTGGAACTTTTGGTTATC
ATGCTCCTGAGTATGCAATGACTGGACAGTTGAATGCAAAGAGTGATGTA
TACAGCTTTGGTGTTGTTCTGCTTGAGCTTCTGACAGGTCGAAAACCTGT
CGATCATACACTACCACGTGGACAGCAGAGTCTAGTGACATGGGCCACAC
CGAAACTTAGTGAAGATAAGGTTAGGCAATGCGTTGATGCAAGACTAGGA
GGAGATTATCCTCCCAAGGCAGTTGCAAAGATGGCTGCAGTTGCTGCTCT
GTGTGTTCAGTATGAAGCTGATTTCCG
back to top