BQ623594

Overview
NameBQ623594
Unique NameBQ623594
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length427
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2221 contig Csv1_Contig2221:826..1252. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: PKNB_MYCBO (Serine/threonine-protein kinase pknB OS=Mycobacterium bovis GN=pknB PE=3 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.951e-11
Identity = 34/82 (41.46%), Postives = 49/82 (59.76%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTR-VLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKP 248
            IIHRD+K +N++I   +  K+ DF ++    D    +  T  V+GT  Y +PE A    ++A+SDVYS G VL E+LTG  P
Sbjct:  134 IIHRDVKPANIMISATNAVKVMDFGIARAIADSGNSVTQTAAVIGTAQYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPP 215          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: PKNA2_BIFLO (Probable serine/threonine-protein kinase pknA2 OS=Bifidobacterium longum GN=pknA2 PE=3 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.951e-11
Identity = 38/88 (43.18%), Postives = 50/88 (56.82%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHST-RVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLP 266
            ++HRDIK  N+LI D    +I DF L+  A    A L ST  +LGT  Y APE     Q  A+ D+YS G++  E+LTG+ P D   P
Sbjct:  136 VVHRDIKPENILINDRGHVQITDFGLAKAASQ--ATLSSTGMLLGTAAYLAPEMIENNQATAQGDLYSVGIMAWEMLTGKVPFDSDNP 221          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: PKN2_CLOPE (Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens GN=CPE1738 PE=3 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.951e-11
Identity = 31/87 (35.63%), Postives = 54/87 (62.07%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLP 266
            IIHRD+K  N+L+ ++ V K+ DF ++ ++ D +   H+  V+G+  Y +PE A     + ++D+YS G+VL E++TG  P +   P
Sbjct:  129 IIHRDVKPQNILVTEEGVVKVTDFGIA-KSMDSSTIAHTNSVMGSAHYFSPEQAKGTYTDYRTDLYSLGIVLYEMVTGVVPFNGDSP 214          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: PKN1_COREF (Probable serine/threonine-protein kinase CE0033 OS=Corynebacterium efficiens GN=CE0033 PE=3 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.951e-11
Identity = 35/88 (39.77%), Postives = 52/88 (59.09%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTR-VLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLP 266
            IIHRD+K +N++I +    K+ DF ++    D  + +  T  V+GT  Y +PE A     +A+SDVY+ G VL EL+TGR P +   P
Sbjct:  132 IIHRDVKPANIMINNTGGVKVMDFGIARALDDSTSAMTQTAAVIGTAQYLSPEQARGKPADARSDVYAAGCVLYELVTGRPPFEGESP 219          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: NRKA_TRYBB (Putative serine/threonine-protein kinase A OS=Trypanosoma brucei brucei GN=NRKA PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.951e-11
Identity = 41/121 (33.88%), Postives = 64/121 (52.89%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWAT----PKLSEDKVRQCVDARLGGD 356
            ++HRDIKS+NVL+    + K+ DF  S+Q  D  + + ++   GT  Y APE     + N K+DV+S GV+L E++  +KP   +  +G  S V   T    P     + ++ VD  L  D
Sbjct:  143 MLHRDIKSANVLLTSTGLVKLGDFGFSHQYEDTVSGVVASTFCGTPYYLAPELWNNKRYNKKADVWSLGVLLYEIMGMKKPFSASNLKGLMSKVLAGTYAPLPDSFSSEFKRVVDGILVAD 263          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: M313B_XENLA (Mitogen-activated protein kinase kinase kinase 13-B OS=Xenopus laevis GN=map3k13-B PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.951e-11
Identity = 35/81 (43.21%), Postives = 48/81 (59.26%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKP 248
            IIHRD+KS NVL+   D  KI+DF  S +  D + ++      GT  + APE      ++ K D++SFGV+L ELLTG  P
Sbjct:  278 IIHRDLKSPNVLVTHADTVKISDFGTSKELSDKSTKM---SFAGTVAWMAPEVIRNEPVSEKVDIWSFGVLLWELLTGEIP 355          
The following BLAST results are available for this feature:
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 246
Match NameE-valueIdentityDescription
PKNB_MYCBO9.951e-1141.46Serine/threonine-protein kinase pknB OS=Mycobacter... [more]
PKNA2_BIFLO9.951e-1143.18Probable serine/threonine-protein kinase pknA2 OS=... [more]
PKN2_CLOPE9.951e-1135.63Probable serine/threonine-protein kinase CPE1738 O... [more]
PKN1_COREF9.951e-1139.77Probable serine/threonine-protein kinase CE0033 OS... [more]
NRKA_TRYBB9.951e-1133.88Putative serine/threonine-protein kinase A OS=Tryp... [more]
M313B_XENLA9.951e-1143.21Mitogen-activated protein kinase kinase kinase 13-... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00685 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00685 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623594 ID=BQ623594|Name=BQ623594|organism=Citrus sinensis|type=EST|length=427bp
CTCATATTATCCATCGCGATATTAAGTCCAGCAATGTACTAATTTTTGAT
GATGATGTAGCAAAGATTGCCGACTTTGATTTATCTAATCAAGCTCCTGA
TATGGCAGCTCGCCTTCATTCTACTCGTGTTCTTGGAACTTTTGGTTATC
ATGCTCCTGAGTATGCAATGACTGGACAGTTGAATGCAAAGAGTGATGTA
TACAGCTTTGGTGTTGTTCTGCTTGAGCTTCTGACAGGTCGAAAACCTGT
CGATCATACACTACCACGTGGACAGCAGAGTCTAGTGACATGGGCCACAC
CGAAACTTAGTGAAGATAAGGTTAGGCAATGCGTTGATGCAAGACTAGGA
GGAGATTATCCTCCCAAGGCAGTTGCAAAGATGGCTGCAGTTGCTGCTCT
GTGTGTTCAGTATGAAGCTGATTTCCG
back to top