BQ623594

Overview
NameBQ623594
Unique NameBQ623594
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length427
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2221 contig Csv1_Contig2221:826..1252. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y5487_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g48740 OS=Arabidopsis thaliana GN=At5g48740 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 4.761e-21
Identity = 55/101 (54.46%), Postives = 66/101 (65.35%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKL 308
            IIHRD+KSSN+L+  D  AK++DF LS Q     A   +T V GT GY  PEY  T QL  KSDVYSFGVVLLEL+ GR+P+ H+      +LV WA P L
Sbjct:  728 IIHRDVKSSNILLDKDMNAKVSDFGLSKQFTKADASHITTVVKGTAGYLDPEYYSTLQLTEKSDVYSFGVVLLELICGREPLSHSGSPDSFNLVLWARPNL 828          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y5241_ARATH (Probable receptor-like protein kinase At5g24010 OS=Arabidopsis thaliana GN=At5g24010 PE=1 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 4.761e-21
Identity = 57/120 (47.50%), Postives = 71/120 (59.17%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPP 365
            IIHRDIKS+N+L+ ++ VAK+ADF LS   P +     ST V G+FGY  PEY    QL  KSDVYSFGVVL E+L  R  VD  L R Q +L  WA     +  + Q VD  +  +  P
Sbjct:  609 IIHRDIKSTNILLDNNYVAKVADFGLSRSGPCIDETHVSTGVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPAVDPLLVREQVNLAEWAIEWQRKGMLDQIVDPNIADEIKP 728          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: WAK5_ARATH (Wall-associated receptor kinase 5 OS=Arabidopsis thaliana GN=WAK5 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.061e-20
Identity = 51/118 (43.22%), Postives = 77/118 (65.25%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDY 359
            IIHRD+K++N+L+ ++  AK+ADF  S   P    +L +T V GT GY  PEY  TG LN KSDVYSFGVVL+ELL+G K +    P+  + LV++    + E+++ + +D ++  +Y
Sbjct:  529 IIHRDVKTANILLDENLTAKVADFGASRLIPMDQEQL-TTMVQGTLGYLDPEYYNTGLLNEKSDVYSFGVVLMELLSGEKALCFERPQSSKHLVSYFVSAMKENRLHEIIDGQVMNEY 645          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y4291_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g29180 OS=Arabidopsis thaliana GN=At4g29180 PE=2 SV=2)

HSP 1 Score: 98.2117 bits (243), Expect = 1.385e-20
Identity = 54/118 (45.76%), Postives = 75/118 (63.56%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDY 359
            I+HRD+K++N+L+ D+  AKIADF LS   P+       T V+GT GY  PEY  T +LN KSDVYSFG+VLLEL+TG++ +  T    + ++V +  P L    +   VD RL GD+
Sbjct:  700 IVHRDVKTANILLNDNLEAKIADFGLSKVFPEDDLSHVVTAVMGTPGYVDPEYYNTFKLNEKSDVYSFGIVLLELITGKRSIMKTDDGEKMNVVHYVEPFLKMGDIDGVVDPRLHGDF 817          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y5389_ARATH (Probable receptor-like protein kinase At5g38990 OS=Arabidopsis thaliana GN=At5g38990 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.809e-20
Identity = 58/136 (42.65%), Postives = 76/136 (55.88%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLH-STRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQ 410
            IIHRDIK++N+L+ ++ VAK++DF LS   P  A++ H ST V GTFGY  PEY     L  KSDVYSFGVVLLE+L  R     ++P  Q  L+ W     ++  V Q +D+ L  D               CVQ
Sbjct:  649 IIHRDIKTTNILLDENFVAKVSDFGLSRVGPTSASQTHVSTVVKGTFGYLDPEYYRRQILTEKSDVYSFGVVLLEVLCCRPIRMQSVPPEQADLIRWVKSNFNKRTVDQIIDSDLTADITSTSMEKFCEIAIRCVQ 784          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: SRF3_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 3 OS=Arabidopsis thaliana GN=SRF3 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.809e-20
Identity = 59/141 (41.84%), Postives = 79/141 (56.03%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSE-DKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEADF 425
            IIHR+ KS+NVL+ DD    ++D  L+      +    S ++L  +GY APE+  +G    +SDVYSFGVV+LELLTGR   D    RG+Q LV WA P+L + D + + VD  L G YP             CVQ E +F
Sbjct:  609 IIHRNFKSANVLLDDDLSVLVSDCGLAPLISSGSVSQLSGQLLAAYGYGAPEFD-SGIYTWQSDVYSFGVVMLELLTGRMSYDRDRSRGEQFLVRWAIPQLHDIDALGKMVDPSLNGQYPAKSLSHFADIISRCVQSEPEF 748          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: RKF3_ARATH (Probable LRR receptor-like serine/threonine-protein kinase RKF3 OS=Arabidopsis thaliana GN=RKF3 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.809e-20
Identity = 59/133 (44.36%), Postives = 75/133 (56.39%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLC 404
            IIHRDIK+SN+L+ +   AK+ADF L+   P+    + STRV GT GY APEYA+ GQL  KSDVYSFGVVLLELL+ RK +         S+  WA   + E +    V+  +    PP           LC
Sbjct:  408 IIHRDIKASNILLDERFEAKVADFGLAKFNPEGMTHM-STRVAGTMGYVAPEYALYGQLTEKSDVYSFGVVLLELLSRRKAIVTDEEGQPVSVADWAWSLVREGQTLDVVEDGMPEKGPPEVLEKYVLIAVLC 539          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: ANX1_ARATH (Receptor-like protein kinase ANXUR1 OS=Arabidopsis thaliana GN=ANX1 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.809e-20
Identity = 52/116 (44.83%), Postives = 72/116 (62.07%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGG 353
            IIHRD+K++N+L+ ++ VAK++DF LS   P+M     +T V G+FGY  PEY    QL  KSDVYSFGVVL E+L  R  ++ +LP+ Q SL  WA     +  +   +D  L G
Sbjct:  637 IIHRDVKTTNILVDENWVAKVSDFGLSKTGPNMNGGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEILCARPALNPSLPKEQVSLGDWAMNCKRKGNLEDIIDPNLKG 752          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y2289_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At2g28960 OS=Arabidopsis thaliana GN=At2g28960 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.363e-20
Identity = 52/120 (43.33%), Postives = 71/120 (59.17%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPP 365
            ++HRD+K++N+L+ +   AK+ADF LS   P       ST V GT GY  PEY  T +LN KSDVYSFG+VLLE++T R  +  T  R +  +  W    L++  +   VD RL  DY P
Sbjct:  694 MVHRDVKTTNILLDEHFQAKLADFGLSRSFPVGGETHVSTAVAGTPGYLDPEYYRTNRLNEKSDVYSFGIVLLEIITSRPVIQQT--REKPHIAAWVGYMLTKGDIENVVDPRLNRDYEP 811          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y5900_ARATH (Putative receptor-like protein kinase At5g39000 OS=Arabidopsis thaliana GN=At5g39000 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.264e-20
Identity = 57/136 (41.91%), Postives = 73/136 (53.68%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLH-STRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQ 410
            IIHRDIK++N+L+ ++ V K++DF LS   P  A++ H ST V GTFGY  PEY     L  KSDVYSFGVVLLE+L  R     ++P  Q  L+ W         V Q +D+ L  D               CVQ
Sbjct:  642 IIHRDIKTTNILLDENFVTKVSDFGLSRVGPTSASQTHVSTVVKGTFGYLDPEYYRRQVLTEKSDVYSFGVVLLEVLCCRPIRMQSVPPEQADLIRWVKSNYRRGTVDQIIDSDLSADITSTSLEKFCEIAVRCVQ 777          
The following BLAST results are available for this feature:
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 246
Match NameE-valueIdentityDescription
Y5487_ARATH4.761e-2154.46Probable LRR receptor-like serine/threonine-protei... [more]
Y5241_ARATH4.761e-2147.50Probable receptor-like protein kinase At5g24010 OS... [more]
WAK5_ARATH1.061e-2043.22Wall-associated receptor kinase 5 OS=Arabidopsis t... [more]
Y4291_ARATH1.385e-2045.76Probable LRR receptor-like serine/threonine-protei... [more]
Y5389_ARATH1.809e-2042.65Probable receptor-like protein kinase At5g38990 OS... [more]
SRF3_ARATH1.809e-2041.84Protein STRUBBELIG-RECEPTOR FAMILY 3 OS=Arabidopsi... [more]
RKF3_ARATH1.809e-2044.36Probable LRR receptor-like serine/threonine-protei... [more]
ANX1_ARATH1.809e-2044.83Receptor-like protein kinase ANXUR1 OS=Arabidopsis... [more]
Y2289_ARATH2.363e-2043.33Probable LRR receptor-like serine/threonine-protei... [more]
Y5900_ARATH5.264e-2041.91Putative receptor-like protein kinase At5g39000 OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00685 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00685 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623594 ID=BQ623594|Name=BQ623594|organism=Citrus sinensis|type=EST|length=427bp
CTCATATTATCCATCGCGATATTAAGTCCAGCAATGTACTAATTTTTGAT
GATGATGTAGCAAAGATTGCCGACTTTGATTTATCTAATCAAGCTCCTGA
TATGGCAGCTCGCCTTCATTCTACTCGTGTTCTTGGAACTTTTGGTTATC
ATGCTCCTGAGTATGCAATGACTGGACAGTTGAATGCAAAGAGTGATGTA
TACAGCTTTGGTGTTGTTCTGCTTGAGCTTCTGACAGGTCGAAAACCTGT
CGATCATACACTACCACGTGGACAGCAGAGTCTAGTGACATGGGCCACAC
CGAAACTTAGTGAAGATAAGGTTAGGCAATGCGTTGATGCAAGACTAGGA
GGAGATTATCCTCCCAAGGCAGTTGCAAAGATGGCTGCAGTTGCTGCTCT
GTGTGTTCAGTATGAAGCTGATTTCCG
back to top