BQ623594

Overview
NameBQ623594
Unique NameBQ623594
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length427
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2221 contig Csv1_Contig2221:826..1252. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y1756_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g07560 OS=Arabidopsis thaliana GN=At1g07560 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.264e-20
Identity = 53/118 (44.92%), Postives = 69/118 (58.47%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDY 359
            I+HRD+KSSN+L+ D   AK+ADF LS   P       ST V GTFGY   EY  T +L+ KSDVYSFGVVLLE++T +  +DH   R    +  W    L+   +   +D +L G Y
Sbjct:  688 IVHRDVKSSNILLDDQLQAKLADFGLSRSFPIGDESHVSTLVAGTFGYLDHEYYQTNRLSEKSDVYSFGVVLLEIITNKPVIDHN--RDMPHIAEWVKLMLTRGDISNIMDPKLQGVY 803          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: FERON_ARATH (Receptor-like protein kinase FERONIA OS=Arabidopsis thaliana GN=FER PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.264e-20
Identity = 55/120 (45.83%), Postives = 70/120 (58.33%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPP 365
            IIHRD+K++N+L+ +  VAK++DF LS   P +     ST V G+FGY  PEY    QL  KSDVYSFGVVL E L  R  ++ TL + Q SL  WA     +  + Q VD  L G   P
Sbjct:  657 IIHRDVKTTNILLDEKWVAKVSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPYLKGKITP 776          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: ERL2_ARATH (LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.264e-20
Identity = 55/115 (47.83%), Postives = 76/115 (66.09%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLH-STRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARL 347
            IIHRDIKSSN+L+  +  A+++DF ++   P  A + + ST VLGT GY  PEYA T +LN KSD+YSFG+VLLELLTG+K VD+     + +L      K  ++ V + VDA +
Sbjct:  772 IIHRDIKSSNILLDGNFEARLSDFGIAKSIP--ATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDN-----EANLHQMILSKADDNTVMEAVDAEV 879          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: SRF4_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 4 OS=Arabidopsis thaliana GN=SRF4 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 6.876e-20
Identity = 56/138 (40.58%), Postives = 78/138 (56.52%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSE-DKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYE 416
            ++H++IKSSN+L+ ++   +++D+ L+N         H T      GY+APE         KSDVYSFGVV+LELLTGRKP D   P+ +QSLV WA P+L + D + + VD  L G Y P           +CV  E
Sbjct:  539 LVHKNIKSSNILLDNELNPRLSDYGLANFH-------HRTSQNLGVGYNAPECTDPSAYTQKSDVYSFGVVMLELLTGRKPYDSGRPKAEQSLVRWAKPQLKDMDTLDEMVDPALCGLYAPESVSSFADIVSICVMTE 669          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: ERL1_ARATH (LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 6.876e-20
Identity = 54/112 (48.21%), Postives = 75/112 (66.96%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLH-STRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVD 338
            IIHRDIKSSN+L+ ++  A ++DF ++   P  A++ H ST VLGT GY  PEYA T ++N KSD+YSFG+VLLELLTG+K VD+     + +L      K  ++ V + VD
Sbjct:  769 IIHRDIKSSNILLDENFEAHLSDFGIAKSIP--ASKTHASTYVLGTIGYIDPEYARTSRINEKSDIYSFGIVLLELLTGKKAVDN-----EANLHQLILSKADDNTVMEAVD 873          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: WAK3_ARATH (Wall-associated receptor kinase 3 OS=Arabidopsis thaliana GN=WAK3 PE=2 SV=2)

HSP 1 Score: 95.5153 bits (236), Expect = 8.980e-20
Identity = 51/111 (45.95%), Postives = 73/111 (65.77%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVD 338
            IIHRDIK++N+L+ ++  AK+ADF  S   P    +L +T V GT GY  PEY  TG LN KSDVYSFGVVL+ELL+G+K +    P+  + LV++      E+++ + +D
Sbjct:  536 IIHRDIKTANILLDENLTAKVADFGASKLIPMDKEQL-TTMVQGTLGYLDPEYYTTGLLNEKSDVYSFGVVLMELLSGQKALCFERPQASKHLVSYFVSATEENRLHEIID 645          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y4391_ARATH (Probable receptor-like protein kinase At4g39110 OS=Arabidopsis thaliana GN=At4g39110 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.173e-19
Identity = 55/120 (45.83%), Postives = 69/120 (57.50%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPP 365
            IIHRD+KS+N+L+ +  VAK+ADF LS           ST V G+FGY  PEY    QL  KSDVYSFGVVLLE L  R  ++  LPR Q +L  WA     +  + + +D  L G   P
Sbjct:  646 IIHRDVKSTNILLDEALVAKVADFGLSKDVA-FGQNHVSTAVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLLEALCARPAINPQLPREQVNLAEWAMQWKRKGLLEKIIDPHLAGTINP 764          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CRK30_ARATH (Putative cysteine-rich receptor-like protein kinase 30 OS=Arabidopsis thaliana GN=CRK30 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.173e-19
Identity = 55/136 (40.44%), Postives = 75/136 (55.15%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVD-HTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQ 410
            IIHRDIK+SN+L+  D   KIADF ++    D      + RV+GTFGY  PEY   GQ + KSDVYSFGV++LE+++GRK    + +     +LVT+     + D   + VD  + G Y             LCVQ
Sbjct:  470 IIHRDIKASNILLDADMNPKIADFGMARNFRDHQTEDSTGRVVGTFGYMPPEYVAHGQFSTKSDVYSFGVLILEIVSGRKNSSFYQMDGSVCNLVTYVWRLWNTDSSLELVDPAISGSYEKDEVTRCIHIGLLCVQ 605          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CRK19_ARATH (Cysteine-rich receptor-like protein kinase 19 OS=Arabidopsis thaliana GN=CRK19 PE=2 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 1.532e-19
Identity = 54/140 (38.57%), Postives = 78/140 (55.71%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVD-HTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEAD 422
            IIHRD+K+ N+L+ DD   KIADF ++           + RV+GT+GY +PEYAM GQ + KSDVYSFGV++LE+++G K    + +     +LVT+     S     + VD   G +Y             LCVQ +A+
Sbjct:  447 IIHRDLKAGNILLDDDMNPKIADFGMARIFGMDQTEAMTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGMKNSSLYQMDESVGNLVTYTWRLWSNGSPSELVDPSFGDNYQTSEITRCIHIALLCVQEDAE 586          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: ANX2_ARATH (Receptor-like protein kinase ANXUR2 OS=Arabidopsis thaliana GN=ANX2 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.532e-19
Identity = 52/120 (43.33%), Postives = 72/120 (60.00%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPP 365
            IIHRD+K++N+L+ ++ VAK++DF LS   P+M     +T V G+FGY  PEY    QL  KSDVYSFGVVL E+L  R  ++ +L + Q SL  WA     +  +   +D  L G   P
Sbjct:  641 IIHRDVKTTNILLDENWVAKVSDFGLSKTGPNMNGGHVTTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEVLCARPALNPSLSKEQVSLGDWAMNCKRKGTLEDIIDPNLKGKINP 760          
The following BLAST results are available for this feature:
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 246
Match NameE-valueIdentityDescription
Y1756_ARATH5.264e-2044.92Probable LRR receptor-like serine/threonine-protei... [more]
FERON_ARATH5.264e-2045.83Receptor-like protein kinase FERONIA OS=Arabidopsi... [more]
ERL2_ARATH5.264e-2047.83LRR receptor-like serine/threonine-protein kinase ... [more]
SRF4_ARATH6.876e-2040.58Protein STRUBBELIG-RECEPTOR FAMILY 4 OS=Arabidopsi... [more]
ERL1_ARATH6.876e-2048.21LRR receptor-like serine/threonine-protein kinase ... [more]
WAK3_ARATH8.980e-2045.95Wall-associated receptor kinase 3 OS=Arabidopsis t... [more]
Y4391_ARATH1.173e-1945.83Probable receptor-like protein kinase At4g39110 OS... [more]
CRK30_ARATH1.173e-1940.44Putative cysteine-rich receptor-like protein kinas... [more]
CRK19_ARATH1.532e-1938.57Cysteine-rich receptor-like protein kinase 19 OS=A... [more]
ANX2_ARATH1.532e-1943.33Receptor-like protein kinase ANXUR2 OS=Arabidopsis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00685 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00685 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623594 ID=BQ623594|Name=BQ623594|organism=Citrus sinensis|type=EST|length=427bp
CTCATATTATCCATCGCGATATTAAGTCCAGCAATGTACTAATTTTTGAT
GATGATGTAGCAAAGATTGCCGACTTTGATTTATCTAATCAAGCTCCTGA
TATGGCAGCTCGCCTTCATTCTACTCGTGTTCTTGGAACTTTTGGTTATC
ATGCTCCTGAGTATGCAATGACTGGACAGTTGAATGCAAAGAGTGATGTA
TACAGCTTTGGTGTTGTTCTGCTTGAGCTTCTGACAGGTCGAAAACCTGT
CGATCATACACTACCACGTGGACAGCAGAGTCTAGTGACATGGGCCACAC
CGAAACTTAGTGAAGATAAGGTTAGGCAATGCGTTGATGCAAGACTAGGA
GGAGATTATCCTCCCAAGGCAGTTGCAAAGATGGCTGCAGTTGCTGCTCT
GTGTGTTCAGTATGAAGCTGATTTCCG
back to top