BQ623594

Overview
NameBQ623594
Unique NameBQ623594
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length427
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2221 contig Csv1_Contig2221:826..1252. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: HSL1_ARATH (Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.000e-19
Identity = 50/116 (43.10%), Postives = 77/116 (66.38%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTR--VLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARL 347
            I+HRDIKS+N+LI  D  A++ADF ++ +A D+  +   +   + G+ GY APEYA T ++N KSD+YSFGVV+LE++T ++PVD  L  G++ LV W    L +  +   +D +L
Sbjct:  811 IVHRDIKSNNILIDGDYGARVADFGVA-KAVDLTGKAPKSMSVIAGSCGYIAPEYAYTLRVNEKSDIYSFGVVILEIVTRKRPVDPEL--GEKDLVKWVCSTLDQKGIEHVIDPKL 923          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: FEI1_ARATH (LRR receptor-like serine/threonine-protein kinase FEI 1 OS=Arabidopsis thaliana GN=FEI1 PE=1 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.000e-19
Identity = 50/116 (43.10%), Postives = 74/116 (63.79%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGG 353
            IIHRDIKSSN+L+  +  A+++DF L+    D  + + +T V GTFGY APEY  +G+   K+DVYSFGV++LE+L+G++P D +      ++V W    +SE + R  VD    G
Sbjct:  425 IIHRDIKSSNILLDGNLEARVSDFGLAKLLEDEESHI-TTIVAGTFGYLAPEYMQSGRATEKTDVYSFGVLVLEVLSGKRPTDASFIEKGLNVVGWLKFLISEKRPRDIVDPNCEG 539          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: BRL3_ARATH (Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.000e-19
Identity = 50/118 (42.37%), Postives = 71/118 (60.17%), Query Frame = 3
Query:    3 HIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGD 356
            HIIHRD+KSSNVL+  D VA+++DF ++     +   L  + + GT GY  PEY  + +  AK DVYS+GV+LLELL+G+KP+D        +LV WA     E +  + +D  L  D
Sbjct:  980 HIIHRDMKSSNVLLDQDFVARVSDFGMARLVSALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSYGVILLELLSGKKPIDPEEFGEDNNLVGWAKQLYREKRGAEILDPELVTD 1097          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y5977_ARATH (Probable leucine-rich repeat receptor-like protein kinase At5g49770 OS=Arabidopsis thaliana GN=At5g49770 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.613e-19
Identity = 47/83 (56.63%), Postives = 58/83 (69.88%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVD 254
            IIHRD+KS+N+L+ +   AK+ADF LS    D      +T+V GT GY  PEY MT QL  KSDVY FGVV+LELLTG+ P+D
Sbjct:  754 IIHRDVKSNNILLDEHLTAKVADFGLSKLVGDPEKAHVTTQVKGTMGYLDPEYYMTNQLTEKSDVYGFGVVMLELLTGKSPID 836          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: PSKR1_ARATH (Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4)

HSP 1 Score: 93.9745 bits (232), Expect = 2.613e-19
Identity = 48/112 (42.86%), Postives = 67/112 (59.82%), Query Frame = 3
Query:    3 HIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVD 338
            HI+HRDIKSSN+L+ ++  + +ADF L+         + ST ++GT GY  PEY        K DVYSFGVVLLELLT ++PVD   P+G + L++W      E +  +  D
Sbjct:  855 HILHRDIKSSNILLDENFNSHLADFGLARLMSPYETHV-STDLVGTLGYIPPEYGQASVATYKGDVYSFGVVLLELLTDKRPVDMCKPKGCRDLISWVVKMKHESRASEVFD 965          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: MEE39_ARATH (Probable LRR receptor-like serine/threonine-protein kinase MEE39 OS=Arabidopsis thaliana GN=MEE39 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.613e-19
Identity = 50/119 (42.02%), Postives = 75/119 (63.03%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLH-STRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDY 359
            ++HRD+KS+N+L+ ++  AKIADF LS        +   ST V GT GY  PEY +T +L+ KSDVYSFG++LLE++T ++ +D T  R   ++  W T  + +    Q VD +L G+Y
Sbjct:  687 MVHRDVKSTNILLDEEFKAKIADFGLSRSFQVGGDQSQVSTVVAGTLGYLDPEYYLTSELSEKSDVYSFGILLLEIITNQRVIDQT--RENPNIAEWVTFVIKKGDTSQIVDPKLHGNY 803          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: FEI2_ARATH (LRR receptor-like serine/threonine-protein kinase FEI 2 OS=Arabidopsis thaliana GN=FEI2 PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.613e-19
Identity = 49/116 (42.24%), Postives = 75/116 (64.66%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGG 353
            IIHRDIKSSN+L+  +  A+++DF L+    D  + + +T V GTFGY APEY  +G+   K+DVYSFGV++LE+L+G+ P D +      ++V W    +SE++ ++ VD    G
Sbjct:  423 IIHRDIKSSNILLDGNLEARVSDFGLAKLLEDEESHI-TTIVAGTFGYLAPEYMQSGRATEKTDVYSFGVLVLEVLSGKLPTDASFIEKGFNIVGWLNFLISENRAKEIVDLSCEG 537          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y1765_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g07650 OS=Arabidopsis thaliana GN=At1g07650 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.412e-19
Identity = 53/118 (44.92%), Postives = 69/118 (58.47%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDY 359
            I+HRDIK+SNVL+  D  AKI+DF L+    D    + STR+ GT GY APEYAM G L  K+DVYSFGVV LE+++G+   +         L+ WA        + + VD  L  DY
Sbjct:  801 IVHRDIKASNVLLDKDLNAKISDFGLAKLNDDGNTHI-STRIAGTIGYMAPEYAMRGYLTEKADVYSFGVVALEIVSGKSNTNFRPTEDFVYLLDWAYVLQERGSLLELVDPTLASDY 917          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: WAK4_ARATH (Wall-associated receptor kinase 4 OS=Arabidopsis thaliana GN=WAK4 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.412e-19
Identity = 50/114 (43.86%), Postives = 74/114 (64.91%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARL 347
            IIHRDIK++N+L+ ++  AK+ADF  S   P M     +T V GT GY  PEY  TG LN KSDVYSFGVVL+ELL+G+K +    P+  + +V++      E+++ + +D ++
Sbjct:  531 IIHRDIKTANILLDENLTAKVADFGASRLIP-MDKEDLATMVQGTLGYLDPEYYNTGLLNEKSDVYSFGVVLMELLSGQKALCFERPQTSKHIVSYFASATKENRLHEIIDGQV 643          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: EXS_ARATH (Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.412e-19
Identity = 50/116 (43.10%), Postives = 70/116 (60.34%), Query Frame = 3
Query:    3 HIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQ-QSLVTWATPKLSEDKVRQCVDARL 347
            HIIHRDIK+SN+L+  D   K+ADF L+       + + ST + GTFGY  PEY  + +   K DVYSFGV+LLEL+TG++P        +  +LV WA  K+++ K    +D  L
Sbjct: 1038 HIIHRDIKASNILLDGDFEPKVADFGLARLISACESHV-STVIAGTFGYIPPEYGQSARATTKGDVYSFGVILLELVTGKEPTGPDFKESEGGNLVGWAIQKINQGKAVDVIDPLL 1152          
The following BLAST results are available for this feature:
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 246
Match NameE-valueIdentityDescription
HSL1_ARATH2.000e-1943.10Receptor-like protein kinase HSL1 OS=Arabidopsis t... [more]
FEI1_ARATH2.000e-1943.10LRR receptor-like serine/threonine-protein kinase ... [more]
BRL3_ARATH2.000e-1942.37Receptor-like protein kinase BRI1-like 3 OS=Arabid... [more]
Y5977_ARATH2.613e-1956.63Probable leucine-rich repeat receptor-like protein... [more]
PSKR1_ARATH2.613e-1942.86Phytosulfokine receptor 1 OS=Arabidopsis thaliana ... [more]
MEE39_ARATH2.613e-1942.02Probable LRR receptor-like serine/threonine-protei... [more]
FEI2_ARATH2.613e-1942.24LRR receptor-like serine/threonine-protein kinase ... [more]
Y1765_ARATH3.412e-1944.92Probable LRR receptor-like serine/threonine-protei... [more]
WAK4_ARATH3.412e-1943.86Wall-associated receptor kinase 4 OS=Arabidopsis t... [more]
EXS_ARATH3.412e-1943.10Leucine-rich repeat receptor protein kinase EXS OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00685 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00685 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623594 ID=BQ623594|Name=BQ623594|organism=Citrus sinensis|type=EST|length=427bp
CTCATATTATCCATCGCGATATTAAGTCCAGCAATGTACTAATTTTTGAT
GATGATGTAGCAAAGATTGCCGACTTTGATTTATCTAATCAAGCTCCTGA
TATGGCAGCTCGCCTTCATTCTACTCGTGTTCTTGGAACTTTTGGTTATC
ATGCTCCTGAGTATGCAATGACTGGACAGTTGAATGCAAAGAGTGATGTA
TACAGCTTTGGTGTTGTTCTGCTTGAGCTTCTGACAGGTCGAAAACCTGT
CGATCATACACTACCACGTGGACAGCAGAGTCTAGTGACATGGGCCACAC
CGAAACTTAGTGAAGATAAGGTTAGGCAATGCGTTGATGCAAGACTAGGA
GGAGATTATCCTCCCAAGGCAGTTGCAAAGATGGCTGCAGTTGCTGCTCT
GTGTGTTCAGTATGAAGCTGATTTCCG
back to top