BQ623594

Overview
NameBQ623594
Unique NameBQ623594
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length427
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2221 contig Csv1_Contig2221:826..1252. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CRK4_ARATH (Cysteine-rich receptor-like protein kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.412e-19
Identity = 55/141 (39.01%), Postives = 80/141 (56.74%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQ--SLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEAD 422
            IIHRD+K+ N+L+ DD  AKIADF ++          ++ R++GT+GY +PEYAM GQ + KSDVYSFGV++LE+++G+K  +     G    +LVT+     S     + VD     +Y             LCVQ EA+
Sbjct:  472 IIHRDLKAGNILLGDDMNAKIADFGMARIFGMDQTEANTRRIVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGKKNSNVYQMDGTSAGNLVTYTWRLWSNGSPLELVDPSFRDNYRINEVSRCIHIALLCVQEEAE 612          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y5614_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g56140 OS=Arabidopsis thaliana GN=At1g56140 PE=1 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 4.457e-19
Identity = 50/114 (43.86%), Postives = 71/114 (62.28%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARL 347
            I+HRD+K+SN+L+    V K++DF L+    D    + STRV GT GY APEYAM G L  K+DVY+FGVV LEL++GR   D  L   ++ L+ WA     + +  + +D +L
Sbjct:  813 IVHRDVKASNILLDSKLVPKVSDFGLAKLYDDKKTHI-STRVAGTIGYLAPEYAMRGHLTEKTDVYAFGVVALELVSGRPNSDENLEDEKRYLLEWAWNLHEKGREVELIDHQL 925          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y2214_ARATH (Probable receptor-like protein kinase At2g21480 OS=Arabidopsis thaliana GN=At2g21480 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.457e-19
Identity = 55/120 (45.83%), Postives = 69/120 (57.50%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPP 365
            IIHRD+KS+N+L+ +  VAK+ADF LS           ST V G+FGY  PEY    QL  KSDVYSFGVVLLE L  R  ++  LPR Q +L  WA     +  + + +D  L G   P
Sbjct:  645 IIHRDVKSTNILLDEALVAKVADFGLSKDVA-FGQNHVSTAVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLLEALCARPAINPQLPREQVNLAEWAMLWKQKGLLEKIIDPHLVGAVNP 763          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CRK6_ARATH (Cysteine-rich receptor-like protein kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.457e-19
Identity = 54/135 (40.00%), Postives = 77/135 (57.04%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQ 410
            IIHRD+K+SN+L+  D   KIADF ++        + +++R++GT+GY APEYAM GQ + KSDVYSFGV++LE+++GRK        G Q L+T A    +  K    VD  +  +              LCVQ
Sbjct:  472 IIHRDLKASNILLDADINPKIADFGMARIFGLDQTQDNTSRIVGTYGYMAPEYAMHGQFSMKSDVYSFGVLVLEIISGRKNSSFGESDGAQDLLTHAWRLWTNKKALDLVDPLIAENCQNSEVVRCIHIGLLCVQ 606          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CRK3_ARATH (Cysteine-rich receptor-like protein kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.457e-19
Identity = 54/139 (38.85%), Postives = 76/139 (54.68%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEAD 422
            IIHRDIK SN+L+ DD   +IADF L+   P+    + ST + GT GY APEY + G+L  K+DVYSFGV+++E++TG++        G      W+  + S   V + VD  LG ++             LCVQ   D
Sbjct:  444 IIHRDIKLSNILLEDDFTPRIADFGLARLFPEDKTHI-STAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLMIEVITGKRNNAFVQDAGSILQSVWSLYRTS--NVEEAVDPILGDNFNKIEASRLLQIGLLCVQAAFD 579          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CRK25_ARATH (Cysteine-rich receptor-like protein kinase 25 OS=Arabidopsis thaliana GN=CRK25 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.457e-19
Identity = 51/138 (36.96%), Postives = 80/138 (57.97%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEA 419
            IIHRD+K+SN+L+  D   KI+DF ++        + ++ R++GT+GY +PEYA+ G+ + KSDVYSFGV++LEL+TG+K        G   LVT+      E+   + VD  + G++             LCVQ ++
Sbjct:  468 IIHRDLKASNILLDADMHPKISDFGMARIFGVDQTQANTKRIVGTYGYMSPEYAIHGKYSVKSDVYSFGVLVLELITGKKNSSFYEEDGLGDLVTYVWKLWVENSPLELVDEAMRGNFQTNEVIRCIHIALLCVQEDS 605          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CRI4_MAIZE (Putative receptor protein kinase CRINKLY4 OS=Zea mays GN=CR4 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.457e-19
Identity = 52/111 (46.85%), Postives = 66/111 (59.46%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVD 338
            +IHRDIKSSN+LI +D  A++ADF LS   P  +    S    GT GY  PEY     L  KSDVYSFGVVLLE+L+GRK +D     G  ++V WA P +    +   +D
Sbjct:  630 VIHRDIKSSNILIDEDHNARVADFGLSILGPADSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQFEEG--NIVEWAVPLIKAGDIFAILD 738          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y1561_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g56130 OS=Arabidopsis thaliana GN=At1g56130 PE=1 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 5.820e-19
Identity = 50/114 (43.86%), Postives = 71/114 (62.28%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARL 347
            I+HRD+K+SN+L+    V +I+DF L+    D    + STRV GT GY APEYAM G L  K+DVY+FGVV LEL++GR   D  L   ++ L+ WA     + +  + +D +L
Sbjct:  814 IVHRDVKASNILLDSRLVPQISDFGLAKLYDDKKTHI-STRVAGTIGYLAPEYAMRGHLTEKTDVYAFGVVALELVSGRPNSDENLEEEKKYLLEWAWNLHEKSRDIELIDDKL 926          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y1534_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53420 OS=Arabidopsis thaliana GN=At1g53420 PE=2 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 5.820e-19
Identity = 50/118 (42.37%), Postives = 70/118 (59.32%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDY 359
            I+HRDIK++NVL+      KI+DF L+    + +  + STR+ GTFGY APEYAM G L  K+DVYSFG+V LE++ GR             L+ W      ++ + + VD RLG +Y
Sbjct:  746 IVHRDIKATNVLLDKQLNPKISDFGLAKLDEEDSTHI-STRIAGTFGYMAPEYAMRGHLTDKADVYSFGIVALEIVHGRSNKIERSKNNTFYLIDWVEVLREKNNLLELVDPRLGSEY 862          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y1105_ARATH (Probable receptor-like protein kinase At1g11050 OS=Arabidopsis thaliana GN=At1g11050 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 5.820e-19
Identity = 51/116 (43.97%), Postives = 73/116 (62.93%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQS--LVTWATPKLSEDKVRQCVDARL 347
            I HRDIK +N+L+  D  A++ADF L+ Q+ +  + L +TRV GT GY APEYA+ GQL  KSDVYSFGVV+LE++ GRK +D +      +  +  WA   +   K  + ++  L
Sbjct:  422 IYHRDIKGTNILLDVDMRARVADFGLAKQSREGESHL-TTRVAGTHGYLAPEYALYGQLTEKSDVYSFGVVILEIMCGRKALDLSTSGSPNTFLITDWAWSLVKAGKTEEALEQSL 536          
The following BLAST results are available for this feature:
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 246
Match NameE-valueIdentityDescription
CRK4_ARATH3.412e-1939.01Cysteine-rich receptor-like protein kinase 4 OS=Ar... [more]
Y5614_ARATH4.457e-1943.86Probable LRR receptor-like serine/threonine-protei... [more]
Y2214_ARATH4.457e-1945.83Probable receptor-like protein kinase At2g21480 OS... [more]
CRK6_ARATH4.457e-1940.00Cysteine-rich receptor-like protein kinase 6 OS=Ar... [more]
CRK3_ARATH4.457e-1938.85Cysteine-rich receptor-like protein kinase 3 OS=Ar... [more]
CRK25_ARATH4.457e-1936.96Cysteine-rich receptor-like protein kinase 25 OS=A... [more]
CRI4_MAIZE4.457e-1946.85Putative receptor protein kinase CRINKLY4 OS=Zea m... [more]
Y1561_ARATH5.820e-1943.86Probable LRR receptor-like serine/threonine-protei... [more]
Y1534_ARATH5.820e-1942.37Probable LRR receptor-like serine/threonine-protei... [more]
Y1105_ARATH5.820e-1943.97Probable receptor-like protein kinase At1g11050 OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00685 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00685 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623594 ID=BQ623594|Name=BQ623594|organism=Citrus sinensis|type=EST|length=427bp
CTCATATTATCCATCGCGATATTAAGTCCAGCAATGTACTAATTTTTGAT
GATGATGTAGCAAAGATTGCCGACTTTGATTTATCTAATCAAGCTCCTGA
TATGGCAGCTCGCCTTCATTCTACTCGTGTTCTTGGAACTTTTGGTTATC
ATGCTCCTGAGTATGCAATGACTGGACAGTTGAATGCAAAGAGTGATGTA
TACAGCTTTGGTGTTGTTCTGCTTGAGCTTCTGACAGGTCGAAAACCTGT
CGATCATACACTACCACGTGGACAGCAGAGTCTAGTGACATGGGCCACAC
CGAAACTTAGTGAAGATAAGGTTAGGCAATGCGTTGATGCAAGACTAGGA
GGAGATTATCCTCCCAAGGCAGTTGCAAAGATGGCTGCAGTTGCTGCTCT
GTGTGTTCAGTATGAAGCTGATTTCCG
back to top