BQ623594

Overview
NameBQ623594
Unique NameBQ623594
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length427
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2221 contig Csv1_Contig2221:826..1252. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y1755_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g07550 OS=Arabidopsis thaliana GN=At1g07550 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 7.602e-19
Identity = 53/118 (44.92%), Postives = 71/118 (60.17%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDY 359
            I+HRD+KS+N+L+ ++  AKIADF LS     +      T V GTFGY  PEY  T  L+ KSDVYSFGVVLLE+++G+  +D  L R   ++V W +  L    +   VD  L  DY
Sbjct:  680 IVHRDVKSTNILLSEEFEAKIADFGLSRSFL-IGNEAQPTVVAGTFGYLDPEYHKTSLLSMKSDVYSFGVVLLEIISGQDVID--LSRENCNIVEWTSFILENGDIESIVDPNLHQDY 794          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: SRF2_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 2 OS=Arabidopsis thaliana GN=SRF2 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 7.602e-19
Identity = 51/144 (35.42%), Postives = 81/144 (56.25%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAP--DMAARLHSTRV-LGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDK-VRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEADF 425
            I H D+K++N+L+ ++   +IAD  L++  P    + +L ++ + +   GY APE+   G    KSD Y+ GV+LLELLTGRK  D + PRG+Q LV WA+ +L + + + Q +D  + G +             LC Q E +F
Sbjct:  537 IAHSDLKATNILLDEELTPRIADCGLASLRPLTSNSVKLRASEIAIQNTGYIAPEHGQPGSSGTKSDTYALGVLLLELLTGRKAFDSSRPRGEQLLVKWASTRLHDRRSLEQMIDGGIAGTFSSRVASQYADIISLCTQAEKEF 680          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: PAM74_ARATH (Probable LRR receptor-like serine/threonine-protein kinase PAM74 OS=Arabidopsis thaliana GN=PAM74 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 7.602e-19
Identity = 50/118 (42.37%), Postives = 71/118 (60.17%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDY 359
            I+HRDIK++N+L+ +   AK+ADF LS   P       ST V GT GY  PEY  T +L  KSDVYSFG+VLLE++T +  +D +  R +  +  W   +L+   + + +D  L GDY
Sbjct:  700 IVHRDIKTTNILLDEQLKAKLADFGLSRSFPIGGETHISTVVAGTPGYLDPEYYQTTRLGEKSDVYSFGIVLLEIITNQPVIDQS--RSKSHISQWVGFELTRGDITKIMDPNLNGDY 815          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CRK21_ARATH (Cysteine-rich receptor-like protein kinase 21 OS=Arabidopsis thaliana GN=CRK21 PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 7.602e-19
Identity = 53/140 (37.86%), Postives = 75/140 (53.57%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVD-HTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEAD 422
            IIHRD+K+SN+L+  +   KIADF L+          ++ RV+GTFGY  PEY   GQ + KSDVYSFGV++LE++ G+K    H +     +LVT      +   + + VD  +G +Y             LCVQ   D
Sbjct:  484 IIHRDLKASNILLDAEMNPKIADFGLARNFRVNQTEANTGRVVGTFGYMPPEYVANGQFSTKSDVYSFGVLILEIIGGKKNSSFHQIDGSVSNLVTHVWRLRNNGSLLELVDPAIGENYDKDEVIRCIHIGLLCVQENPD 623          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: BRL1_ARATH (Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 7.602e-19
Identity = 49/118 (41.53%), Postives = 71/118 (60.17%), Query Frame = 3
Query:    3 HIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGD 356
            HIIHRD+KSSNVL+ +D  A+++DF ++     +   L  + + GT GY  PEY  + +  AK DVYS+GV+LLELL+G+KP+D        +LV WA     E +  + +D  L  D
Sbjct:  982 HIIHRDMKSSNVLLDEDFEARVSDFGMARLVSALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSYGVILLELLSGKKPIDPGEFGEDNNLVGWAKQLYREKRGAEILDPELVTD 1099          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y5613_ARATH (Probable receptor-like protein kinase At5g61350 OS=Arabidopsis thaliana GN=At5g61350 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 9.928e-19
Identity = 51/116 (43.97%), Postives = 73/116 (62.93%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGG 353
            IIHRD+K++N+L+ ++ VAK++DF LS  AP     + ST V G+FGY  PEY    QL  KSDVYSFGVVL E+L  R  ++  LPR Q +L  +A     +  + + +D ++ G
Sbjct:  651 IIHRDVKTTNILLDENLVAKVSDFGLSKDAPMDEGHV-STAVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPVINPQLPREQVNLAEYAMNLHRKGMLEKIIDPKIVG 765          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CRK5_ARATH (Cysteine-rich receptor-like protein kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 9.928e-19
Identity = 52/140 (37.14%), Postives = 77/140 (55.00%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVD-HTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEAD 422
            IIHRD+K+ N+L+  D   K+ADF ++          H+ RV+GT+GY +PEYAM GQ + KSDVYSFGV++LE+++GRK    + +     +LVT+     S+      VD+     Y             LCVQ + +
Sbjct:  461 IIHRDLKAGNILLDADMNPKVADFGMARIFEIDQTEAHTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGRKNSSLYQMDASFGNLVTYTWRLWSDGSPLDLVDSSFRDSYQRNEIIRCIHIALLCVQEDTE 600          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y5596_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g59680 OS=Arabidopsis thaliana GN=At5g59680 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.297e-18
Identity = 47/118 (39.83%), Postives = 72/118 (61.02%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDY 359
            ++HRD+K++N+L+ +   AK+ADF LS   P       ST + GT GY  PEY  T +L+ KSDVYSFG+VLLE++T +  +D    R +  +  W   +L+   + + +D +L GDY
Sbjct:  701 MVHRDVKTTNILLDEHYKAKLADFGLSRSFPVGGESHVSTVIAGTPGYLDPEYYHTSRLSEKSDVYSFGIVLLEMITNQAVIDRN--RRKSHITQWVGSELNGGDIAKIMDLKLNGDY 816          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y4245_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g20450 OS=Arabidopsis thaliana GN=At4g20450 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.297e-18
Identity = 51/118 (43.22%), Postives = 70/118 (59.32%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDY 359
            +IHRDIKS N+L+ ++  AK+ DF LS   P  +    ST V G+ GY  PEY  T  L  KSDV+SFGVVLLE++T +  +D T  R +  +  W   KL+   ++  VD  + GDY
Sbjct:  712 MIHRDIKSMNILLDNNFQAKLGDFGLSRSFPVGSETHVSTNVAGSPGYLDPEYYRTNWLTEKSDVFSFGVVLLEIITSQPVIDQT--REKSHIGEWVGFKLTNGDIKNIVDPSMNGDY 827          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CLV1_ARATH (Receptor protein kinase CLAVATA1 OS=Arabidopsis thaliana GN=CLV1 PE=1 SV=3)

HSP 1 Score: 91.6633 bits (226), Expect = 1.297e-18
Identity = 60/147 (40.82%), Postives = 84/147 (57.14%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQ---------CVDARLGGDYPPXXXXXXXXXXXLCVQYEA 419
            I+HRD+KS+N+L+  D  A +ADF L+    D AA    + + G++GY APEYA T +++ KSDVYSFGVVLLEL+ G+KPV      G   +V W   + +E+++ Q          VD RL G YP            +CV+ EA
Sbjct:  813 ILHRDVKSNNILLDSDFEAHVADFGLAKFLVDGAASECMSSIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGKKPVGE-FGEG-VDIVRWV--RNTEEEITQPSDAAIVVAIVDPRLTG-YPLTSVIHVFKIAMMCVEEEA 954          
The following BLAST results are available for this feature:
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 246
Match NameE-valueIdentityDescription
Y1755_ARATH7.602e-1944.92Probable LRR receptor-like serine/threonine-protei... [more]
SRF2_ARATH7.602e-1935.42Protein STRUBBELIG-RECEPTOR FAMILY 2 OS=Arabidopsi... [more]
PAM74_ARATH7.602e-1942.37Probable LRR receptor-like serine/threonine-protei... [more]
CRK21_ARATH7.602e-1937.86Cysteine-rich receptor-like protein kinase 21 OS=A... [more]
BRL1_ARATH7.602e-1941.53Serine/threonine-protein kinase BRI1-like 1 OS=Ara... [more]
Y5613_ARATH9.928e-1943.97Probable receptor-like protein kinase At5g61350 OS... [more]
CRK5_ARATH9.928e-1937.14Cysteine-rich receptor-like protein kinase 5 OS=Ar... [more]
Y5596_ARATH1.297e-1839.83Probable LRR receptor-like serine/threonine-protei... [more]
Y4245_ARATH1.297e-1843.22Probable LRR receptor-like serine/threonine-protei... [more]
CLV1_ARATH1.297e-1840.82Receptor protein kinase CLAVATA1 OS=Arabidopsis th... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00685 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00685 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623594 ID=BQ623594|Name=BQ623594|organism=Citrus sinensis|type=EST|length=427bp
CTCATATTATCCATCGCGATATTAAGTCCAGCAATGTACTAATTTTTGAT
GATGATGTAGCAAAGATTGCCGACTTTGATTTATCTAATCAAGCTCCTGA
TATGGCAGCTCGCCTTCATTCTACTCGTGTTCTTGGAACTTTTGGTTATC
ATGCTCCTGAGTATGCAATGACTGGACAGTTGAATGCAAAGAGTGATGTA
TACAGCTTTGGTGTTGTTCTGCTTGAGCTTCTGACAGGTCGAAAACCTGT
CGATCATACACTACCACGTGGACAGCAGAGTCTAGTGACATGGGCCACAC
CGAAACTTAGTGAAGATAAGGTTAGGCAATGCGTTGATGCAAGACTAGGA
GGAGATTATCCTCCCAAGGCAGTTGCAAAGATGGCTGCAGTTGCTGCTCT
GTGTGTTCAGTATGAAGCTGATTTCCG
back to top