BQ623594

Overview
NameBQ623594
Unique NameBQ623594
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length427
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2221 contig Csv1_Contig2221:826..1252. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y2232_ARATH (Probable receptor-like protein kinase At2g23200 OS=Arabidopsis thaliana GN=At2g23200 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.694e-18
Identity = 50/116 (43.10%), Postives = 71/116 (61.21%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGG 353
            IIHRD+KS+N+L+ + ++AK+ADF LS       + + S  + GTFGY  PEY  T +L  KSDVY+FGVVLLE+L  R  +D  LP  + +L  W     S+  + + +D  L G
Sbjct:  609 IIHRDVKSTNILLDEHNIAKVADFGLSKIHNQDESNI-SINIKGTFGYLDPEYLQTHKLTEKSDVYAFGVVLLEVLFARPAIDPYLPHEEVNLSEWVMFCKSKGTIDEILDPSLIG 723          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CRK23_ARATH (Putative cysteine-rich receptor-like protein kinase 23 OS=Arabidopsis thaliana GN=CRK23 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.212e-18
Identity = 52/140 (37.14%), Postives = 75/140 (53.57%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVD-HTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEAD 422
            IIHRD+K+ N+L+  D   K+ADF ++          ++ RV+GT+GY APEYAM GQ + KSDVYSFGV++ E+++G K    + +     +LVT+     S       VD   G +Y             LCVQ + D
Sbjct:  629 IIHRDLKAGNILLDADMNPKVADFGMARIFGMDQTEANTRRVVGTYGYMAPEYAMYGQFSMKSDVYSFGVLVFEIISGMKNSSLYQMDDSVSNLVTYTWRLWSNGSQLDLVDPSFGDNYQTHDITRCIHIALLCVQEDVD 768          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: ACCR4_ARATH (Serine/threonine-protein kinase-like protein CCR4 OS=Arabidopsis thaliana GN=CCR4 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.212e-18
Identity = 52/117 (44.44%), Postives = 69/117 (58.97%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAP---DMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARL 347
            +IHRDIKSSN+L+     AK++DF LS   P   D  + L S    GT GY  PEY    QL  KSDVYSFGVVLLELL+G K + +      ++LV +  P +  D+  + +D R+
Sbjct:  575 VIHRDIKSSNILLDATWTAKVSDFGLSQMGPTEEDDVSHL-SLHAAGTLGYIDPEYYKFQQLTTKSDVYSFGVVLLELLSGHKAIHNNEDENPRNLVEYVVPYILLDEAHRILDQRI 690          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CRK35_ARATH (Putative cysteine-rich receptor-like protein kinase 35 OS=Arabidopsis thaliana GN=CRK35 PE=3 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 2.889e-18
Identity = 52/136 (38.24%), Postives = 76/136 (55.88%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVD-HTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQ 410
            IIHRD+K+SN+L+  D   KIADF ++       ++ ++ R+ GTFGY +PEYAM G  + KSDVYSFGV++LE+++G+K    + +     +LVT A          + VD  +G  Y             LCVQ
Sbjct:  466 IIHRDLKASNILLDADMNPKIADFGMARIFGVDQSQANTRRIAGTFGYMSPEYAMRGHFSMKSDVYSFGVLVLEIISGKKNSSFYNIDDSGSNLVTHAWRLWRNGSPLELVDPTIGESYQSSEATRCIHIALLCVQ 601          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CRK33_ARATH (Putative cysteine-rich receptor-like protein kinase 33 OS=Arabidopsis thaliana GN=CRK33 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.889e-18
Identity = 51/140 (36.43%), Postives = 80/140 (57.14%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVD-HTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEAD 422
            IIHRD+K+SN+L+  +   K+ADF ++       +R  + RV+GT GY +PEY M GQ + KSDVYSFGV++LE+++G++  + H      ++LVT+A          + VD+ L  +Y             LCVQ + +
Sbjct:  442 IIHRDLKASNILLDAEMEPKVADFGMARIFRVDQSRADTRRVVGTHGYISPEYLMHGQFSVKSDVYSFGVLVLEIISGKRNSNFHETDESGKNLVTYAWRHWRNGSPLELVDSELEKNYQSNEVFRCIHIALLCVQNDPE 581          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CRK20_ARATH (Putative cysteine-rich receptor-like protein kinase 20 OS=Arabidopsis thaliana GN=CRK20 PE=2 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 2.889e-18
Identity = 53/140 (37.86%), Postives = 77/140 (55.00%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQ-QSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEAD 422
            IIHRD+K+ N+L+  D   K+ADF ++          ++ RV+GT+GY APEYAM G+ + KSDVYSFGV++LE+++G K        G   +LVT+     S     + VD   G +Y             LCVQ +A+
Sbjct:  465 IIHRDLKAGNILLDADMNPKVADFGMARIFGMDQTEANTRRVVGTYGYMAPEYAMYGKFSMKSDVYSFGVLVLEIVSGMKNSSLDQMDGSISNLVTYTWRLWSNGSPSELVDPSFGDNYQTSEITRCIHIALLCVQEDAN 604          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CRK11_ARATH (Cysteine-rich receptor-like protein kinase 11 OS=Arabidopsis thaliana GN=CRK11 PE=2 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 2.889e-18
Identity = 54/140 (38.57%), Postives = 79/140 (56.43%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRK-----PVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQ 410
            IIHRD+K+SN+L+  D   KIADF L+        + ++ R+ GT+ Y +PEYAM GQ + KSD+YSFGV++LE+++G+K      +D T   G  +LVT+A+         + VD   G +Y             LCVQ
Sbjct:  471 IIHRDLKASNILLDADMNPKIADFGLATIFGVEQTQGNTNRIAGTYAYMSPEYAMHGQYSMKSDIYSFGVLVLEIISGKKNSGVYQMDETSTAG--NLVTYASRLWRNKSPLELVDPTFGRNYQSNEVTRCIHIALLCVQ 608          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: RLK5_ARATH (Receptor-like protein kinase 5 OS=Arabidopsis thaliana GN=RLK5 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 3.773e-18
Identity = 47/116 (40.52%), Postives = 70/116 (60.34%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTR--VLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARL 347
            I+HRD+KSSN+L+  D  AK+ADF ++       ++       + G+ GY APEY  T ++N KSD+YSFGVVLLEL+TG++P D  L  G + +  W    L +  +   +D +L
Sbjct:  815 IVHRDVKSSNILLDSDYGAKVADFGIAKVGQMSGSKTPEAMSGIAGSCGYIAPEYVYTLRVNEKSDIYSFGVVLLELVTGKQPTDSEL--GDKDMAKWVCTALDKCGLEPVIDPKL 928          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: IKU2_ARATH (Receptor-like protein kinase HAIKU2 OS=Arabidopsis thaliana GN=IKU2 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 3.773e-18
Identity = 49/122 (40.16%), Postives = 76/122 (62.30%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSN--QAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLV-TWATPK-LSEDKVRQCVDARLGGDY 359
            +IHRD+KSSN+L+ ++   +IADF L+   QA  +     +  V GT GY APEYA T ++N KSDVYSFGVVL+EL+TG+KP++         ++  W+  K  + + + + +D  +  +Y
Sbjct:  810 VIHRDVKSSNILLDEEWRPRIADFGLAKIIQADSVQRDFSAPLVKGTLGYIAPEYAYTTKVNEKSDVYSFGVVLMELVTGKKPLETDFGENNDIVMWVWSVSKETNREMMMKLIDTSIEDEY 931          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CRK8_ARATH (Cysteine-rich receptor-like protein kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=2)

HSP 1 Score: 90.1225 bits (222), Expect = 3.773e-18
Identity = 52/135 (38.52%), Postives = 75/135 (55.56%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQ 410
            IIHRD+K+SN+L+  D   KIADF ++        + +++R++GT+GY APEYAM GQ + KSDVYSFGV++LE+++GRK        G Q L+T      +       VD  +  +              LCVQ
Sbjct:  474 IIHRDLKASNILLDADINPKIADFGMARIFGLDQTQDNTSRIVGTYGYMAPEYAMHGQFSMKSDVYSFGVLVLEIISGRKNSSFDESDGAQDLLTHTWRLWTNRTALDLVDPLIANNCQNSEVVRCIHIGLLCVQ 608          
The following BLAST results are available for this feature:
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 246
Match NameE-valueIdentityDescription
Y2232_ARATH1.694e-1843.10Probable receptor-like protein kinase At2g23200 OS... [more]
CRK23_ARATH2.212e-1837.14Putative cysteine-rich receptor-like protein kinas... [more]
ACCR4_ARATH2.212e-1844.44Serine/threonine-protein kinase-like protein CCR4 ... [more]
CRK35_ARATH2.889e-1838.24Putative cysteine-rich receptor-like protein kinas... [more]
CRK33_ARATH2.889e-1836.43Putative cysteine-rich receptor-like protein kinas... [more]
CRK20_ARATH2.889e-1837.86Putative cysteine-rich receptor-like protein kinas... [more]
CRK11_ARATH2.889e-1838.57Cysteine-rich receptor-like protein kinase 11 OS=A... [more]
RLK5_ARATH3.773e-1840.52Receptor-like protein kinase 5 OS=Arabidopsis thal... [more]
IKU2_ARATH3.773e-1840.16Receptor-like protein kinase HAIKU2 OS=Arabidopsis... [more]
CRK8_ARATH3.773e-1838.52Cysteine-rich receptor-like protein kinase 8 OS=Ar... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00685 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00685 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623594 ID=BQ623594|Name=BQ623594|organism=Citrus sinensis|type=EST|length=427bp
CTCATATTATCCATCGCGATATTAAGTCCAGCAATGTACTAATTTTTGAT
GATGATGTAGCAAAGATTGCCGACTTTGATTTATCTAATCAAGCTCCTGA
TATGGCAGCTCGCCTTCATTCTACTCGTGTTCTTGGAACTTTTGGTTATC
ATGCTCCTGAGTATGCAATGACTGGACAGTTGAATGCAAAGAGTGATGTA
TACAGCTTTGGTGTTGTTCTGCTTGAGCTTCTGACAGGTCGAAAACCTGT
CGATCATACACTACCACGTGGACAGCAGAGTCTAGTGACATGGGCCACAC
CGAAACTTAGTGAAGATAAGGTTAGGCAATGCGTTGATGCAAGACTAGGA
GGAGATTATCCTCCCAAGGCAGTTGCAAAGATGGCTGCAGTTGCTGCTCT
GTGTGTTCAGTATGAAGCTGATTTCCG
back to top