CA588039
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CA588039 vs. ExPASy Swiss-Prot
Match: GBB4_RAT (Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus GN=Gnb4 PE=2 SV=4) HSP 1 Score: 66.6254 bits (161), Expect = 7.568e-11 Identity = 31/66 (46.97%), Postives = 42/66 (63.64%), Query Frame = 3 Query: 3 FSISGRLLFAGYSNGDCYVWDTLLAKVVLNLGSLQNSHEGRITCLGLSADGSALCTGSWDTNLKIW 200 FS SGRLL AGY + +C VWD L + H+ R++CLG++ DG A+ TGSWD+ L+IW Sbjct: 278 FSKSGRLLLAGYDDFNCSVWDALKG----GRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIW 339
BLAST of CA588039 vs. ExPASy Swiss-Prot
Match: GBB4_MOUSE (Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus GN=Gnb4 PE=2 SV=4) HSP 1 Score: 66.6254 bits (161), Expect = 7.568e-11 Identity = 31/66 (46.97%), Postives = 42/66 (63.64%), Query Frame = 3 Query: 3 FSISGRLLFAGYSNGDCYVWDTLLAKVVLNLGSLQNSHEGRITCLGLSADGSALCTGSWDTNLKIW 200 FS SGRLL AGY + +C VWD L + H+ R++CLG++ DG A+ TGSWD+ L+IW Sbjct: 278 FSKSGRLLLAGYDDFNCSVWDALKG----GRSGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIW 339
BLAST of CA588039 vs. ExPASy Swiss-Prot
Match: GBB2_CAEEL (Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2) HSP 1 Score: 66.2402 bits (160), Expect = 9.885e-11 Identity = 32/67 (47.76%), Postives = 43/67 (64.18%), Query Frame = 3 Query: 3 FSISGRLLFAGYSNGDCYVWDTLLAKVVLNLGSLQNSHEGRITCLGLSADGSALCTGSWDTNLKIWA 203 FS+SGR+LFAGY + VWD+L S+ HE RI+CL S DG+A+C+ SWD ++IWA Sbjct: 294 FSLSGRILFAGYGDYRVGVWDSLKCA----RHSVLYGHENRISCLRTSPDGTAVCSASWDCTIRIWA 356 The following BLAST results are available for this feature:
BLAST of CA588039 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 43
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CA588039 ID=CA588039; Name=CA588039; organism=Citrus sinensis; type=EST; length=516bpback to top |