CB250291

Overview
NameCB250291
Unique NameCB250291
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length594
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig113 contig Csv1_Contig113:1..594. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250291 vs. ExPASy Swiss-Prot
Match: DERL1_MOUSE (Derlin-1 OS=Mus musculus GN=Derl1 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.578e-11
Identity = 34/82 (41.46%), Postives = 50/82 (60.98%), Query Frame = 3
Query:  108 LTLMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVFVGASAWVDLLGMIAGHAYYFLEDVYPR-MTGRRPLKTPSFI 350
            L + ++YVW++ N  + +SF     F A YLPWV+LGF+  +G S   +L+G + GH Y+FL   YP  + GR  L TP F+
Sbjct:  125 LIMSVLYVWAQLNRDLIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFL 206          
BLAST of CB250291 vs. ExPASy Swiss-Prot
Match: DERL1_PONAB (Derlin-1 OS=Pongo abelii GN=DERL1 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 4.674e-11
Identity = 34/82 (41.46%), Postives = 50/82 (60.98%), Query Frame = 3
Query:  108 LTLMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVFVGASAWVDLLGMIAGHAYYFLEDVYPR-MTGRRPLKTPSFI 350
            L + ++YVW++ N  + +SF     F A YLPWV+LGF+  +G S   +L+G + GH Y+FL   YP  + GR  L TP F+
Sbjct:  125 LIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFL 206          
BLAST of CB250291 vs. ExPASy Swiss-Prot
Match: DERL1_HUMAN (Derlin-1 OS=Homo sapiens GN=DERL1 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 4.674e-11
Identity = 34/82 (41.46%), Postives = 50/82 (60.98%), Query Frame = 3
Query:  108 LTLMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVFVGASAWVDLLGMIAGHAYYFLEDVYPR-MTGRRPLKTPSFI 350
            L + ++YVW++ N  + +SF     F A YLPWV+LGF+  +G S   +L+G + GH Y+FL   YP  + GR  L TP F+
Sbjct:  125 LIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFL 206          
BLAST of CB250291 vs. ExPASy Swiss-Prot
Match: DERL1_BOVIN (Derlin-1 OS=Bos taurus GN=DERL1 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 4.674e-11
Identity = 34/82 (41.46%), Postives = 50/82 (60.98%), Query Frame = 3
Query:  108 LTLMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVFVGASAWVDLLGMIAGHAYYFLEDVYPR-MTGRRPLKTPSFI 350
            L + ++YVW++ N  + +SF     F A YLPWV+LGF+  +G S   +L+G + GH Y+FL   YP  + GR  L TP F+
Sbjct:  125 LIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFL 206          
The following BLAST results are available for this feature:
BLAST of CB250291 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
DERL1_MOUSE3.578e-1141.46Derlin-1 OS=Mus musculus GN=Derl1 PE=2 SV=1[more]
DERL1_PONAB4.674e-1141.46Derlin-1 OS=Pongo abelii GN=DERL1 PE=2 SV=1[more]
DERL1_HUMAN4.674e-1141.46Derlin-1 OS=Homo sapiens GN=DERL1 PE=1 SV=1[more]
DERL1_BOVIN4.674e-1141.46Derlin-1 OS=Bos taurus GN=DERL1 PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0068 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ091 similar to unknown Arabidopsis protein (acc# NP_192395), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250291 ID=CB250291|Name=CB250291|organism=Citrus sinensis|type=EST|length=594bp
ACATGCTTTTATTTGGAGCCACTTTTCTAACCGGCACTGTTCTTATTGGG
GGGATGATACCTTACTTGTCAGAATCATTTGCAAAAATCATTTTCCTTAG
CAATTCATTGACACTCATGATGGTTTATGTATGGAGCAAACAAAATCCTT
TCATCCACATGAGTTTTTTGGGCCTTTTTACATTTACAGCAGCTTACTTA
CCATGGGTGCTCTTGGGATTCTCAGTCTTCGTTGGCGCTAGCGCTTGGGT
GGATTTGCTGGGGATGATAGCCGGTCATGCCTACTATTTTCTCGAAGATG
TTTATCCTAGGATGACAGGTCGCCGGCCCTTAAAAACACCATCTTTTATC
AAAGCACTGTTTGCGGATGAGGCTGTAGTGGTAGCACGGCCTGCAAATGT
GAGATTTGCTCCACCACCTGCAGAGGAAGTTCACCAAGACTAATGAGAAC
CTTTGAGGGATGGGACTCTCTTGAGGGCTCACTTTTGGTTTGTATTGATC
TGTATGGGAAATCTGCGACCTGCAGAAAGTGTTGTTGACCCATGTCTTGA
AAGTATTTATGTGAACTAGCTAATTATGGTGTTTATGTCATAAG
back to top