CB250306

Overview
NameCB250306
Unique NameCB250306
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length322
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_SACKL (Elongation factor 2 OS=Saccharomyces kluyveri GN=EFT2 PE=3 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 3.875e-36
Identity = 73/106 (68.87%), Postives = 83/106 (78.30%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRP 320
            LNEIKDSVVA FQWASKEG +  E MR +   + DV LHADAIHRGGGQ+IPT RR  YA  L A+P++ EPV+LVEIQ PEQA+GGIYSVLN+KRG V  E QRP
Sbjct:  656 LNEIKDSVVAAFQWASKEGPIFGEQMRSVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLAEPKIQEPVFLVEIQCPEQAVGGIYSVLNRKRGQVVSEEQRP 761          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_KLULA (Elongation factor 2 OS=Kluyveromyces lactis GN=EFT1 PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 6.609e-36
Identity = 72/106 (67.92%), Postives = 83/106 (78.30%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRP 320
            LNEIKDSVVA FQWA+KEG +  E MR +   + DV LHADAIHRGGGQ+IPT RR  YA  L A+P++ EPV+LVEIQ PEQA+GGIYSVLN+KRG V  E QRP
Sbjct:  656 LNEIKDSVVAAFQWATKEGPIFGEQMRSVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLAEPKIQEPVFLVEIQCPEQAIGGIYSVLNKKRGQVVSEEQRP 761          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_SACCA (Elongation factor 2 OS=Saccharomyces castellii GN=EFT1 PE=3 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 3.280e-35
Identity = 71/106 (66.98%), Postives = 82/106 (77.36%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRP 320
            LNEIKDSVVA FQWA+KEG +  E MR +   + DV LHADAIHRGGGQ+IPT RR  YA  L A+P++ EPV+LVEIQ PE A+GGIYSVLN+KRG V  E QRP
Sbjct:  656 LNEIKDSVVAAFQWATKEGPIFGEQMRSVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLAEPKIQEPVFLVEIQCPESAVGGIYSVLNKKRGQVVSEEQRP 761          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_YEAST (Elongation factor 2 OS=Saccharomyces cerevisiae GN=EFT1 PE=1 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 5.595e-35
Identity = 71/106 (66.98%), Postives = 82/106 (77.36%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRP 320
            L+EIKDSVVA FQWA+KEG +  E MR +   + DV LHADAIHRGGGQ+IPT RR  YA  L A P++ EPV+LVEIQ PEQA+GGIYSVLN+KRG V  E QRP
Sbjct:  656 LHEIKDSVVAAFQWATKEGPIFGEEMRSVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLADPKIQEPVFLVEIQCPEQAVGGIYSVLNKKRGQVVSEEQRP 761          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_CRYPV (Elongation factor 2 OS=Cryptosporidium parvum PE=3 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 5.595e-35
Identity = 68/102 (66.67%), Postives = 82/102 (80.39%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEE 308
            L EIKD   + FQWA+KEG L EE+MRGI F + DV LHADAIHRG GQ+ PT RRV+YA+ LTA PRLLEP++LVEI AP++ +GGIY+ LNQ+RGHVF E
Sbjct:  646 LTEIKDHCNSAFQWATKEGILCEEDMRGIRFNLLDVTLHADAIHRGAGQITPTCRRVMYAAALTASPRLLEPMFLVEISAPQEVVGGIYATLNQRRGHVFHE 747          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_PICPA (Elongation factor 2 OS=Pichia pastoris GN=EFT1 PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 9.544e-35
Identity = 71/106 (66.98%), Postives = 84/106 (79.25%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRP 320
            L+EIKDSVVAGFQ A+KEG +  ENMR +   + DV LHADAIHRGGGQVIPT +RV YA+ L A+P + EP++LVEIQ PE A+GGIYSVLN+KRG V  E QRP
Sbjct:  656 LHEIKDSVVAGFQLATKEGPILGENMRSVRVNILDVTLHADAIHRGGGQVIPTMKRVTYAAFLLAEPAIQEPIFLVEIQCPENAIGGIYSVLNKKRGQVISEEQRP 761          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_CANGA (Elongation factor 2 OS=Candida glabrata GN=EFT1 PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 1.628e-34
Identity = 69/106 (65.09%), Postives = 82/106 (77.36%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRP 320
            LNEIKDSVV+ FQWA+KEG +  E MR +   + DV LHADAIHRG GQ++PT RR  YA  L A+P++ EPV+LVEIQ PEQA+GGIYSVLN+KRG V  E QRP
Sbjct:  656 LNEIKDSVVSAFQWATKEGPILGETMRSVRVNILDVTLHADAIHRGAGQIMPTMRRATYAGFLLAEPKIQEPVFLVEIQCPEQAVGGIYSVLNKKRGQVVSEEQRP 761          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_ASHGO (Elongation factor 2 OS=Ashbya gossypii GN=EFT1 PE=3 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 2.777e-34
Identity = 69/106 (65.09%), Postives = 82/106 (77.36%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRP 320
            LNEIKDSVV+ FQWA+KEG +  E MR +   + DV LHADAIHRG GQ++PT RR  YA  L A+P++ EPV+LVEIQ PEQA+GGIYSVLN+KRG V  E QRP
Sbjct:  656 LNEIKDSVVSAFQWATKEGPIFGEQMRSVRINLLDVTLHADAIHRGAGQIMPTMRRATYAGFLLAEPKIQEPVFLVEIQCPEQAVGGIYSVLNRKRGQVVSEEQRP 761          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: SN114_SCHPO (114 kDa U5 small nuclear ribonucleoprotein component homolog OS=Schizosaccharomyces pombe GN=cwf10 PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.335e-28
Identity = 56/106 (52.83%), Postives = 79/106 (74.53%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRP 320
            LN +K+ +  GFQW ++EG L +E +R + F + DVVL  + I+RGGGQ+IPTARRV Y+S LTA PRL+EPVY+VE+ AP  +L  IY +L ++RGHV +++ RP
Sbjct:  772 LNSVKEYIKQGFQWGTREGPLCDETIRNVNFRLMDVVLAPEQIYRGGGQIIPTARRVCYSSFLTASPRLMEPVYMVEVHAPADSLPIIYDLLTRRRGHVLQDIPRP 877          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_ENTHI (Elongation factor 2 OS=Entamoeba histolytica GN=EF-2 PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 1.743e-28
Identity = 59/106 (55.66%), Postives = 76/106 (71.70%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRP 320
            LNE+KDS+V GF  A  +G +  E +RG+   + DV LHADAIHRGG Q+IP ARR  +A  LT  P LLEP+YL EIQ PE A+GGIY+V++++RG +  E QRP
Sbjct:  654 LNEVKDSIVNGFNNAMHDGVVCNEQIRGVRINLEDVKLHADAIHRGGAQMIPCARRCCFACVLTGAPSLLEPMYLAEIQCPESAIGGIYTVMSRRRGKIISEEQRP 759          
The following BLAST results are available for this feature:
BLAST of CB250306 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 95
Match NameE-valueIdentityDescription
EF2_SACKL3.875e-3668.87Elongation factor 2 OS=Saccharomyces kluyveri GN=E... [more]
EF2_KLULA6.609e-3667.92Elongation factor 2 OS=Kluyveromyces lactis GN=EFT... [more]
EF2_SACCA3.280e-3566.98Elongation factor 2 OS=Saccharomyces castellii GN=... [more]
EF2_YEAST5.595e-3566.98Elongation factor 2 OS=Saccharomyces cerevisiae GN... [more]
EF2_CRYPV5.595e-3566.67Elongation factor 2 OS=Cryptosporidium parvum PE=3... [more]
EF2_PICPA9.544e-3566.98Elongation factor 2 OS=Pichia pastoris GN=EFT1 PE=... [more]
EF2_CANGA1.628e-3465.09Elongation factor 2 OS=Candida glabrata GN=EFT1 PE... [more]
EF2_ASHGO2.777e-3465.09Elongation factor 2 OS=Ashbya gossypii GN=EFT1 PE=... [more]
SN114_SCHPO1.335e-2852.83114 kDa U5 small nuclear ribonucleoprotein compone... [more]
EF2_ENTHI1.743e-2855.66Elongation factor 2 OS=Entamoeba histolytica GN=EF... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0090 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ125 similar to elongation factor 2 (acc# BAA77028), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250306 ID=CB250306|Name=CB250306|organism=Citrus sinensis|type=EST|length=322bp
ACTTGAATGAAATTAAGGATTCAGTTGTTGCTGGGTTCCAGTGGGCATCA
AAGGAAGGTGCATTGGCTGAAGAAAACATGAGGGGCATTTGCTTTGAAGT
TTGTGATGTGGTTCTTCATGCCGATGCTATCCACAGAGGTGGTGGCCAGG
TTATTCCAACTGCTAGAAGGGTCATTTATGCATCCCAGCTTACAGCCAAA
CCAAGGCTTCTTGAGCCTGTCTACTTGGTGGAAATCCAAGCTCCTGAACA
GGCACTTGGTGGTATTTACAGTGTTCTTAACCAGAAACGTGGTCACGTTT
TTGAGGAGATGCAGAGACCTGG
back to top