CB250306

Overview
NameCB250306
Unique NameCB250306
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length322
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_PYRAR (Elongation factor 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=fusA PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.479e-19
Identity = 43/105 (40.95%), Postives = 68/105 (64.76%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQR 317
            L EI+D +V GF+WA + G LA+E MRG+   + D V+H D  HRG  Q++P  +  I+A+ L+A+P LLEP+  ++I+     +G + SVLN+ RG + +  Q+
Sbjct:  562 LREIRDYIVQGFRWAMEAGPLAQEPMRGVKVVLVDAVVHEDPAHRGPAQIMPATKNAIFAAVLSARPTLLEPLVRLDIKVAPDYIGSVTSVLNKHRGKILDMTQQ 666          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_AERPE (Elongation factor 2 OS=Aeropyrum pernix GN=fusA PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.479e-19
Identity = 45/99 (45.45%), Postives = 66/99 (66.67%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHV 299
            L E+KD+++AGF+ A KEG LA E +RG+   + D V+H D +HRG GQ+ P  R  I+A  L  +P LLEP+  ++I+AP + L  I +VL +KRG +
Sbjct:  559 LREVKDTIIAGFRLALKEGPLAAEPVRGVKVVLHDAVIHEDPVHRGPGQLYPAVRNAIWAGILDGRPTLLEPLQKLDIRAPMEYLSNITAVLTRKRGRI 657          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_THENV (Elongation factor 2 OS=Thermoproteus neutrophilus (strain DSM 2338 / JCM 9278 / V24Sta) GN=fusA PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.932e-19
Identity = 42/105 (40.00%), Postives = 69/105 (65.71%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQR 317
            L EI+D +V GF+WA++ G LA+E MRG+   + D V+H D  HRG  Q++P  +  I+A+ L+A+P +LEP+  ++I+     +G + SVLN+ RG + +  Q+
Sbjct:  562 LREIRDYIVQGFRWATEAGPLAQEPMRGLKVVLTDAVVHEDPAHRGPAQIMPATKNAIFAAVLSARPTILEPLMKLDIKVAPDYIGAVTSVLNKHRGKILDMTQQ 666          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_PYRAE (Elongation factor 2 OS=Pyrobaculum aerophilum GN=fusA PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.295e-19
Identity = 42/105 (40.00%), Postives = 68/105 (64.76%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQR 317
            L EI+D +V GF+W+ + G LA+E MRG+   + D V+H D  HRG  Q++P  +  I+A+ L+A+P LLEP+  ++I+     +G + SVLN+ RG + +  Q+
Sbjct:  562 LREIRDYIVQGFRWSMEAGPLAQEPMRGVKVVLVDAVVHEDPAHRGPAQIMPATKNAIFAAVLSARPTLLEPLMRLDIKVAPDYIGAVTSVLNKHRGKILDMTQQ 666          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_IGNH4 (Elongation factor 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=fusA PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.635e-18
Identity = 42/101 (41.58%), Postives = 64/101 (63.37%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFE 305
            L E+KD+++AG++ A KEG LA+E +RG+   + D V+H D  HRG  Q+ P  R  +YAS LT  P LLEP   ++I+ P + +G +  V+ + RG + E
Sbjct:  563 LREVKDTILAGWRLAMKEGPLAKEPVRGVKVILWDAVIHEDPAHRGPAQLYPAVRNAVYASMLTDSPTLLEPWQKLDIRVPNEYIGAVTGVITKHRGKILE 663          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_PYRCJ (Elongation factor 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=fusA PE=3 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.136e-18
Identity = 39/105 (37.14%), Postives = 68/105 (64.76%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQR 317
            L EI+D ++ GF+WA + G LA+E +RG+   + D V+H D  HRG  Q++P  +  I+A+ L+A+P +LEP+  ++I+     +G + SV+N+ RG + +  Q+
Sbjct:  562 LREIRDYIIQGFRWAMEAGPLAQEPIRGVKVVLVDAVVHEDPAHRGPAQIMPATKNAIFAAFLSARPTILEPLVRLDIKVAPDYIGAVTSVINKHRGKILDMTQQ 666          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_SULSO (Elongation factor 2 OS=Sulfolobus solfataricus GN=fusA PE=1 SV=3)

HSP 1 Score: 90.5077 bits (223), Expect = 2.790e-18
Identity = 42/104 (40.38%), Postives = 65/104 (62.50%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            L E+ D+V+ GF+ A KEG LA E +RG+   + D V+H D  HRG  Q+ P  R  I+A  LT++P LLEP+  ++I+ P   +G + +V+ +KRG + +  Q
Sbjct:  560 LREVMDTVLQGFRLAMKEGPLAHEPIRGVKVILHDAVIHEDPAHRGPAQIYPAVRNSIFAGFLTSRPTLLEPIQKLDIRVPADLIGNVTAVITRKRGKILDVSQ 663          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_SULIY (Elongation factor 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=fusA PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.790e-18
Identity = 42/104 (40.38%), Postives = 65/104 (62.50%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            L E+ D+V+ GF+ A KEG LA E +RG+   + D V+H D  HRG  Q+ P  R  I+A  LT++P LLEP+  ++I+ P   +G + +V+ +KRG + +  Q
Sbjct:  560 LREVMDTVLQGFRLAMKEGPLAHEPIRGVKVILHDAVIHEDPAHRGPAQIYPAVRNSIFAGFLTSRPTLLEPIQKLDIRVPADLIGNVTAVITRKRGKILDVSQ 663          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_SULIN (Elongation factor 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=fusA PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.790e-18
Identity = 42/104 (40.38%), Postives = 65/104 (62.50%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            L E+ D+V+ GF+ A KEG LA E +RG+   + D V+H D  HRG  Q+ P  R  I+A  LT++P LLEP+  ++I+ P   +G + +V+ +KRG + +  Q
Sbjct:  560 LREVMDTVLQGFRLAMKEGPLAHEPIRGVKVILHDAVIHEDPAHRGPAQIYPAVRNSIFAGFLTSRPTLLEPIQKLDIRVPADLIGNVTAVITRKRGKILDVSQ 663          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_SULIM (Elongation factor 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=fusA PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.790e-18
Identity = 42/104 (40.38%), Postives = 65/104 (62.50%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            L E+ D+V+ GF+ A KEG LA E +RG+   + D V+H D  HRG  Q+ P  R  I+A  LT++P LLEP+  ++I+ P   +G + +V+ +KRG + +  Q
Sbjct:  560 LREVMDTVLQGFRLAMKEGPLAHEPIRGVKVILHDAVIHEDPAHRGPAQIYPAVRNSIFAGFLTSRPTLLEPIQKLDIRVPADLIGNVTAVITRKRGKILDVSQ 663          
The following BLAST results are available for this feature:
BLAST of CB250306 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 95
Match NameE-valueIdentityDescription
EF2_PYRAR1.479e-1940.95Elongation factor 2 OS=Pyrobaculum arsenaticum (st... [more]
EF2_AERPE1.479e-1945.45Elongation factor 2 OS=Aeropyrum pernix GN=fusA PE... [more]
EF2_THENV1.932e-1940.00Elongation factor 2 OS=Thermoproteus neutrophilus ... [more]
EF2_PYRAE3.295e-1940.00Elongation factor 2 OS=Pyrobaculum aerophilum GN=f... [more]
EF2_IGNH41.635e-1841.58Elongation factor 2 OS=Ignicoccus hospitalis (stra... [more]
EF2_PYRCJ2.136e-1837.14Elongation factor 2 OS=Pyrobaculum calidifontis (s... [more]
EF2_SULSO2.790e-1840.38Elongation factor 2 OS=Sulfolobus solfataricus GN=... [more]
EF2_SULIY2.790e-1840.38Elongation factor 2 OS=Sulfolobus islandicus (stra... [more]
EF2_SULIN2.790e-1840.38Elongation factor 2 OS=Sulfolobus islandicus (stra... [more]
EF2_SULIM2.790e-1840.38Elongation factor 2 OS=Sulfolobus islandicus (stra... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0090 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ125 similar to elongation factor 2 (acc# BAA77028), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250306 ID=CB250306|Name=CB250306|organism=Citrus sinensis|type=EST|length=322bp
ACTTGAATGAAATTAAGGATTCAGTTGTTGCTGGGTTCCAGTGGGCATCA
AAGGAAGGTGCATTGGCTGAAGAAAACATGAGGGGCATTTGCTTTGAAGT
TTGTGATGTGGTTCTTCATGCCGATGCTATCCACAGAGGTGGTGGCCAGG
TTATTCCAACTGCTAGAAGGGTCATTTATGCATCCCAGCTTACAGCCAAA
CCAAGGCTTCTTGAGCCTGTCTACTTGGTGGAAATCCAAGCTCCTGAACA
GGCACTTGGTGGTATTTACAGTGTTCTTAACCAGAAACGTGGTCACGTTT
TTGAGGAGATGCAGAGACCTGG
back to top