CB250306

Overview
NameCB250306
Unique NameCB250306
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length322
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_SULIL (Elongation factor 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=fusA PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.790e-18
Identity = 42/104 (40.38%), Postives = 65/104 (62.50%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            L E+ D+V+ GF+ A KEG LA E +RG+   + D V+H D  HRG  Q+ P  R  I+A  LT++P LLEP+  ++I+ P   +G + +V+ +KRG + +  Q
Sbjct:  560 LREVMDTVLQGFRLAMKEGPLAHEPIRGVKVILHDAVIHEDPAHRGPAQIYPAVRNSIFAGFLTSRPTLLEPIQKLDIRVPADLIGNVTAVITRKRGKILDVSQ 663          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_SULIK (Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=fusA PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.790e-18
Identity = 42/104 (40.38%), Postives = 65/104 (62.50%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            L E+ D+V+ GF+ A KEG LA E +RG+   + D V+H D  HRG  Q+ P  R  I+A  LT++P LLEP+  ++I+ P   +G + +V+ +KRG + +  Q
Sbjct:  560 LREVMDTVLQGFRLAMKEGPLAHEPIRGVKVILHDAVIHEDPAHRGPAQIYPAVRNSIFAGFLTSRPTLLEPIQKLDIRVPADLIGNVTAVITRKRGKILDVSQ 663          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_SULIA (Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.27) GN=fusA PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.790e-18
Identity = 42/104 (40.38%), Postives = 65/104 (62.50%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            L E+ D+V+ GF+ A KEG LA E +RG+   + D V+H D  HRG  Q+ P  R  I+A  LT++P LLEP+  ++I+ P   +G + +V+ +KRG + +  Q
Sbjct:  560 LREVMDTVLQGFRLAMKEGPLAHEPIRGVKVILHDAVIHEDPAHRGPAQIYPAVRNSIFAGFLTSRPTLLEPIQKLDIRVPADLIGNVTAVITRKRGKILDVSQ 663          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_SULAC (Elongation factor 2 OS=Sulfolobus acidocaldarius GN=fusA PE=1 SV=3)

HSP 1 Score: 89.7373 bits (221), Expect = 4.758e-18
Identity = 45/104 (43.27%), Postives = 66/104 (63.46%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            L EI D+++ GF+ A KEG LA E +RG+   + D V+H D  HRG  Q+ P  R  I+A  LT+KP LLEP+  ++I+ P + LG + +V+ +KRG V   +Q
Sbjct:  561 LREIMDTLLQGFRLAMKEGPLAFEPVRGVKVVLHDAVVHEDPAHRGPAQLYPAVRNAIFAGILTSKPTLLEPLQKLDIRIPMEYLGNVTAVITRKRGKVINVVQ 664          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_SULTO (Elongation factor 2 OS=Sulfolobus tokodaii GN=fusA PE=3 SV=3)

HSP 1 Score: 87.8113 bits (216), Expect = 1.808e-17
Identity = 41/104 (39.42%), Postives = 63/104 (60.58%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            L E+ D+++ GF+ A KEG LA E +RG+   + D ++H D  HRG  Q+ P  R  I+A  LT+KP LLEP+  ++I+ P   +G +  V+ +KRG +    Q
Sbjct:  561 LREVMDTILQGFRLAMKEGPLAHEPIRGLKVVLHDAIIHEDPAHRGPAQLYPAVRNAIFAGFLTSKPTLLEPLQKLDIRVPMDFVGNVSGVITRKRGKILNMTQ 664          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_METS5 (Elongation factor 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=fusA PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 4.028e-17
Identity = 41/104 (39.42%), Postives = 65/104 (62.50%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            L EI D+++ G++ A +EG LA E +RG+   + D  +H D  HRG  Q+ P  R  I+A+ L +KP LLEP+  ++I+ P + +G + +VL++KRG V    Q
Sbjct:  560 LREIMDTMLQGYRLAMREGPLAHEPIRGVKVILHDATIHEDPAHRGPAQIYPAVRNAIFAAMLMSKPTLLEPLQKLDIRVPMEFVGNVTAVLSRKRGKVLNMTQ 663          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_METS3 (Elongation factor 2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=fusA PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 2.611e-16
Identity = 40/101 (39.60%), Postives = 62/101 (61.39%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFE 305
            L+E+K+ ++ GF+ A  +G LA+E   G+ F++ D  LH DA+HRG  QV+P  R  IYAS ++A P LLEP+  V I  P+  +G     +  +RG + +
Sbjct:  554 LDEVKELLIEGFESALNDGPLAKEIAMGLKFKLHDAKLHEDAVHRGPAQVLPAIRNAIYASMMSAGPTLLEPMQKVFINTPQDYMGPCTREIQNRRGQIVD 654          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_ENCCU (Elongation factor 2 OS=Encephalitozoon cuniculi GN=EFT1 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 7.597e-16
Identity = 44/97 (45.36%), Postives = 58/97 (59.79%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRG 293
            +NEIK+ V  GF+ A  +G L  E MRG+ FE+ D VLHADAIHRG  Q++   + +     L A P L EP+Y VEI  P    G + ++L  KRG
Sbjct:  664 INEIKEHVNTGFRAAVNDGPLIGEVMRGLKFELKDAVLHADAIHRGINQLLQPVKNLCKGLLLAAGPILYEPIYEVEITTPNDYSGAVTTILLSKRG 760          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_METKA (Elongation factor 2 OS=Methanopyrus kandleri GN=fusA PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 9.922e-16
Identity = 39/105 (37.14%), Postives = 62/105 (59.05%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQR 317
            LNE+ + ++ GF+ A +EG LA+E  RG+   + D  +H D +HRG  QVIP  +R IY   L A   LLEP+  + +  P+  +G +   +  +RG + EE+Q+
Sbjct: 1077 LNEVMELLIEGFEEAMEEGPLAKEPCRGVKVSLVDAEIHEDPVHRGPAQVIPAIKRAIYGGMLLADTHLLEPMQYIYVTVPQDYMGAVTKEIQGRRGTI-EEIQQ 1180          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_METJA (Elongation factor 2 OS=Methanocaldococcus jannaschii GN=fusA PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 9.922e-16
Identity = 40/104 (38.46%), Postives = 62/104 (59.62%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            L+E+K+ ++ GF+ A + G LA E  +G+  ++ D VLH DAIHRG  Q+IP AR  I  + + A P LLEP+  V I  P+  +G     ++ +RG + +  Q
Sbjct:  559 LDEVKELIIQGFKEAMRNGPLAAEKCQGVKVKLMDAVLHEDAIHRGPAQMIPAARFGIRDAMMQANPVLLEPMQFVYINTPQDFMGAAMREISNRRGQILDMEQ 662          
The following BLAST results are available for this feature:
BLAST of CB250306 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 95
Match NameE-valueIdentityDescription
EF2_SULIL2.790e-1840.38Elongation factor 2 OS=Sulfolobus islandicus (stra... [more]
EF2_SULIK2.790e-1840.38Elongation factor 2 OS=Sulfolobus islandicus (stra... [more]
EF2_SULIA2.790e-1840.38Elongation factor 2 OS=Sulfolobus islandicus (stra... [more]
EF2_SULAC4.758e-1843.27Elongation factor 2 OS=Sulfolobus acidocaldarius G... [more]
EF2_SULTO1.808e-1739.42Elongation factor 2 OS=Sulfolobus tokodaii GN=fusA... [more]
EF2_METS54.028e-1739.42Elongation factor 2 OS=Metallosphaera sedula (stra... [more]
EF2_METS32.611e-1639.60Elongation factor 2 OS=Methanobrevibacter smithii ... [more]
EF2_ENCCU7.597e-1645.36Elongation factor 2 OS=Encephalitozoon cuniculi GN... [more]
EF2_METKA9.922e-1637.14Elongation factor 2 OS=Methanopyrus kandleri GN=fu... [more]
EF2_METJA9.922e-1638.46Elongation factor 2 OS=Methanocaldococcus jannasch... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0090 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ125 similar to elongation factor 2 (acc# BAA77028), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250306 ID=CB250306|Name=CB250306|organism=Citrus sinensis|type=EST|length=322bp
ACTTGAATGAAATTAAGGATTCAGTTGTTGCTGGGTTCCAGTGGGCATCA
AAGGAAGGTGCATTGGCTGAAGAAAACATGAGGGGCATTTGCTTTGAAGT
TTGTGATGTGGTTCTTCATGCCGATGCTATCCACAGAGGTGGTGGCCAGG
TTATTCCAACTGCTAGAAGGGTCATTTATGCATCCCAGCTTACAGCCAAA
CCAAGGCTTCTTGAGCCTGTCTACTTGGTGGAAATCCAAGCTCCTGAACA
GGCACTTGGTGGTATTTACAGTGTTCTTAACCAGAAACGTGGTCACGTTT
TTGAGGAGATGCAGAGACCTGG
back to top