CB290207

Overview
NameCB290207
Unique NameCB290207
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length724
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9664 contig Csv1_Contig9664:772..1495. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: CATB3_GIALA (Cathepsin B-like CP3 OS=Giardia lamblia GN=CP3 PE=2 SV=2)

HSP 1 Score: 124.405 bits (311), Expect = 6.136e-28
Identity = 58/122 (47.54%), Postives = 75/122 (61.48%), Query Frame = -2
Query:  295 CVRKCVKKNQLWRNSKHSSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKFGVYKHIPGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAG 660
            C  KC   + L    K +    Y +  D   IM  +   GP++ +FTVY DF +Y+ GVY+H  G V GGHAV ++G+GT DDG DYWI+ N W   WG DGYF+I R +NECGIEE V+ G
Sbjct:  176 CPTKCADGSDLPHLYKATKAVDYGL--DAPAIMKALATGGPLQTAFTVYSDFMYYESGVYQHTYGRVEGGHAVDMVGYGTDDDGVDYWIIKNSWGPDWGEDGYFRIIRMTNECGIEEQVIGG 295          
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: CATB2_GIALA (Cathepsin B-like CP2 OS=Giardia lamblia GN=CP2 PE=1 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 4.862e-25
Identity = 52/122 (42.62%), Postives = 75/122 (61.48%), Query Frame = -2
Query:  295 CVRKCVKKNQLWRNSKHSSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKFGVYKHIPGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAG 660
            C  KC   +     +  +S   Y +  D   +M  +  +GP++V+F V+ DF +Y+ GVY+H  G + GGHAV+++G+GT DDG DYWI+ N W   WG DGYF++ RG N+C IEE   AG
Sbjct:  177 CPTKCADGSSKVHLATATSYKDYGL--DIPAMMKALSTSGPLQVAFLVHSDFMYYESGVYQHTYGYMEGGHAVEMVGYGTDDDGVDYWIIKNSWGPDWGEDGYFRMIRGINDCSIEEQAYAG 296          
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: TINAG_HUMAN (Tubulointerstitial nephritis antigen OS=Homo sapiens GN=TINAG PE=2 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 4.551e-23
Identity = 60/163 (36.81%), Postives = 84/163 (51.53%), Query Frame = -2
Query:  298 PYFDSTGCSHPGCEPA---------YPTPKCVRKCVKKNQLWRNSKHSSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKFGVYKHIPGD--------VMGGHAVKLIGWGT----SDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVA 723
            P F     ++ GC  A         + T  C     K N++++ S       YR++S+  +IM EI +NGPV+    V EDF HYK G+Y+H+            +  HAVKL GWGT        E +WI AN W +SWG +GYF+I RG NE  IE+ ++A
Sbjct:  308 PLFKDQNATNNGCAMASRSDGRGKRHATKPCPNNVEKSNRIYQCSP-----PYRVSSNETEIMKEIMQNGPVQAIMQVREDFFHYKTGIYRHVTSTNKESEKYRKLQTHAVKLTGWGTLRGAQGQKEKFWIAANSWGKSWGENGYFRILRGVNESDIEKLIIA 465          
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: TINAG_BOVIN (Tubulointerstitial nephritis antigen OS=Bos taurus GN=TINAG PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.014e-22
Identity = 64/179 (35.75%), Postives = 90/179 (50.28%), Query Frame = -2
Query:  250 PYFDSTGCSHPGCEPA---------YPTPKCVRKCVKKNQLWRNSKHSSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKFGVYKHIPGDVMGG--------HAVKLIGWGT----SDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSKNLVKEITSAD 723
            P F     ++ GC  A         + T  C     K N++++ S       YR++S+  +IM EI +NGPV+    V+EDF +YK G+Y+HI               HAVKL GWGT        E +WI AN W +SWG +GYF+I RG NE  IE+ ++A          ++TSAD
Sbjct:  308 PLFKDQNATNNGCAMASRSDGRGKRHATTPCPNSIEKSNRIYQCSP-----PYRVSSNETEIMREIMQNGPVQAIMQVHEDFFNYKTGIYRHITSTNEDSEKYRKFRTHAVKLTGWGTLRGAQGQKEKFWIAANSWGKSWGENGYFRILRGVNESDIEKLIIAAW-------GQLTSAD 474          
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: CATB1_GIALA (Cathepsin B-like CP1 OS=Giardia lamblia GN=CP1 PE=2 SV=3)

HSP 1 Score: 104.76 bits (260), Expect = 5.031e-22
Identity = 43/91 (47.25%), Postives = 63/91 (69.23%), Query Frame = -2
Query:  298 IMAEIYKNGPVEVSFTVYEDFAHYKFGVYKHIPGDV-MGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVA 567
            IM  +   GP++    VY D ++Y+ GVYKH  G + +G HA++++G+GT+DDG DYWI+ N W   WG +GYF+I RG NEC IE+++ A
Sbjct:  209 IMGMLVAGGPLQTMIVVYADLSYYESGVYKHTYGTINLGFHALEIVGYGTTDDGTDYWIIKNSWGPDWGENGYFRIVRGVNECRIEDEIYA 299          
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: CATC_PONAB (Dipeptidyl-peptidase 1 OS=Pongo abelii GN=CTSC PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.239e-20
Identity = 54/145 (37.24%), Postives = 78/145 (53.79%), Query Frame = -2
Query:  280 EPAYPTPKCVRKCVKKNQLWR--NSKHSSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKFGVYKHI-------PGDVMGGHAVKLIGWGT-SDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSK 684
            E  +P       C  K   +R  +S++  +  +    +   +  E+  +GP+ V+F VY+DF HYK G+Y H        P ++   HAV L+G+GT S  G DYWI+ N W   WG DGYF+I+RG++EC IE   VA  P  K
Sbjct:  319 EACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTGLRDPFNPFELTN-HAVLLVGYGTDSASGMDYWIVKNSWGTGWGEDGYFRIRRGTDECAIESIAVAATPIPK 462          
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: CATC_MACFA (Dipeptidyl-peptidase 1 OS=Macaca fascicularis GN=CTSC PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.619e-20
Identity = 54/145 (37.24%), Postives = 79/145 (54.48%), Query Frame = -2
Query:  280 EPAYPTPKCVRKCVKKNQLWR--NSKHSSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKFGVYKHI-------PGDVMGGHAVKLIGWGT-SDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSK 684
            E  +P       C  K   +R  +S++  +  +    +   +  E+  +GP+ V+F VY+DF HY+ G+Y H        P ++   HAV L+G+GT S  G DYWI+ N W  SWG DGYF+I+RG++EC IE   VA  P  K
Sbjct:  319 EACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVYHGPLAVAFEVYDDFLHYQNGIYHHTGLRDPFNPFELTN-HAVLLVGYGTDSASGMDYWIVKNSWGTSWGEDGYFRIRRGTDECAIESIAVAATPIPK 462          
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: CATC_HUMAN (Dipeptidyl-peptidase 1 OS=Homo sapiens GN=CTSC PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.709e-20
Identity = 53/145 (36.55%), Postives = 78/145 (53.79%), Query Frame = -2
Query:  280 EPAYPTPKCVRKCVKKNQLWR--NSKHSSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKFGVYKHI-------PGDVMGGHAVKLIGWGT-SDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSK 684
            E  +P       C  K   +R  +S++  +  +    +   +  E+  +GP+ V+F VY+DF HYK G+Y H        P ++   HAV L+G+GT S  G DYWI+ N W   WG +GYF+I+RG++EC IE   VA  P  K
Sbjct:  319 EACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTGLRDPFNPFELTN-HAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPK 462          
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: TINAL_MOUSE (Tubulointerstitial nephritis antigen-like OS=Mus musculus GN=Tinagl1 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.049e-19
Identity = 57/151 (37.75%), Postives = 78/151 (51.66%), Query Frame = -2
Query:  301 AYPTPKCV----------RKCVKK---NQLWRNSKHSSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKFGVYKHIPGDV--------MGGHAVKLIGWG--TSDDGE--DYWILANQWNRSWGADGYFKIKRGSNECGIEEDVV 678
            A PTP+C+          R+   +    Q+  N  +    AYR+ SD ++IM E+ +NGPV+    V+EDF  Y+ G+Y H P            G H+VK+ GWG  T  DG    YW  AN W   WG  G+F+I RG+NEC IE  V+
Sbjct:  302 ASPTPRCMMHSRAMGRGKRQATSRCPNGQVDSNDIYQVTPAYRLGSDEKEIMKELMENGPVQALMEVHEDFFLYQRGIYSHTPVSQGRPEQYRRHGTHSVKITGWGEETLPDGRTIKYWTAANSWGPWWGERGHFRIVRGTNECDIETFVL 452          
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: CATC_CANFA (Dipeptidyl-peptidase 1 (Fragment) OS=Canis familiaris GN=CTSC PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.049e-19
Identity = 47/101 (46.53%), Postives = 64/101 (63.37%), Query Frame = -2
Query:  280 EIYKNGPVEVSFTVYEDFAHYKFGVYKHI-------PGDVMGGHAVKLIGWGT-SDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSK 558
            E+ ++GP+ V+F VY+DF HY+ G+Y H        P ++   HAV L+G+GT S  G DYWI+ N W   WG DGYF+I+RG++EC IE   VA  P  K
Sbjct:  335 ELVRHGPMAVAFEVYDDFFHYQKGIYYHTGLRDPFNPFELTN-HAVLLVGYGTDSASGMDYWIVKNSWGSRWGEDGYFRIRRGTDECAIESIAVAATPIPK 434          
The following BLAST results are available for this feature:
BLAST of CB290207 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 57
Match NameE-valueIdentityDescription
CATB3_GIALA6.136e-2847.54Cathepsin B-like CP3 OS=Giardia lamblia GN=CP3 PE=... [more]
CATB2_GIALA4.862e-2542.62Cathepsin B-like CP2 OS=Giardia lamblia GN=CP2 PE=... [more]
TINAG_HUMAN4.551e-2336.81Tubulointerstitial nephritis antigen OS=Homo sapie... [more]
TINAG_BOVIN1.014e-2235.75Tubulointerstitial nephritis antigen OS=Bos taurus... [more]
CATB1_GIALA5.031e-2247.25Cathepsin B-like CP1 OS=Giardia lamblia GN=CP1 PE=... [more]
CATC_PONAB1.239e-2037.24Dipeptidyl-peptidase 1 OS=Pongo abelii GN=CTSC PE=... [more]
CATC_MACFA1.619e-2037.24Dipeptidyl-peptidase 1 OS=Macaca fascicularis GN=C... [more]
CATC_HUMAN4.709e-2036.55Dipeptidyl-peptidase 1 OS=Homo sapiens GN=CTSC PE=... [more]
TINAL_MOUSE1.049e-1937.75Tubulointerstitial nephritis antigen-like OS=Mus m... [more]
CATC_CANFA1.049e-1946.53Dipeptidyl-peptidase 1 (Fragment) OS=Canis familia... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_01aa10_b1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_01aa10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB290207 ID=CB290207|Name=CB290207|organism=Citrus sinensis|type=EST|length=724bp
AAAGATGCGACATTTTTCAACTAAACGAATAATTCGGGGAGGAGAAACCA
AGTTATTACAACTGGTTCTATTTTTACACCCAACATTAAACTCCATTAAT
ACATTCAATTATGCAAGACGGGAGCTTCCCATTTCATGCCTTGATAGCTT
AGGTTCAACGATACACCCCTATAGCTACACATTTGATATATAAATAACAA
CATGAAGGGATAGCAAAGTCTGCTCTCAAGCTGAAGCATCCTCAAACATA
TCTGCACTTGTAATCTCTTTGACAAGATTTTTGGATGAAGGCAAACCAGC
AACCACATCCTCTTCAATACCACACTCATTTGATCCTCTTTTAATCTTGA
AGTAACCATCCGCACCCCAGCTTCTATTCCACTGATTAGCGAGAATCCAG
TAATCCTCGCCATCATCACTAGTTCCCCAACCAATAAGCTTAACAGCATG
ACCCCCCATTACATCGCCTGGGATGTGTTTGTAAACCCCAAATTTGTAGT
GAGCAAAATCCTCATAAACTGTGAAGGAAACTTCAACTGGTCCATTCTTG
TAAATTTCTGCCATTATGTCCTCTGGATCAGAATTGATTCTATATGCACT
AATACTGGAGTGCTTTGAATTCCTCCAAAGCTGGTTTTTCTTGACGCACT
TCCTCACACACTTTGGAGTAGGATATGCCGGCTCACAACCAGGGTGGGAA
CAGCCAGTACTATCAAAGTAGGGA
back to top