CB304754

Overview
NameCB304754
Unique NameCB304754
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length577
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB304754 vs. ExPASy Swiss-Prot
Match: ASSY_CLOBA (Argininosuccinate synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=argG PE=3 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 9.985e-64
Identity = 111/182 (60.99%), Postives = 144/182 (79.12%), Query Frame = -1
Query:   32 LDTSVIVPWLRENYGCEVVCFTADVGQGIKELDGLEEKAKASGACQLVVKDLKEEFVKDYIFPCLRAGAIYERKYLLGTSMARPVIAKAMVDVAREVGADAVAHGCTGKGNDQVRFELTFFALNPELNVVAPWREWDIQGREDAIEYAKKHNVPVPVTKKSIYSRDRNLWHLSHEGDILEDP 577
            LDTS+I+PWL+ENY CEV+    +VGQ   ELDGLEEKA  +GA +L ++DL +EFV+DYIFP ++AGAIYE KYLLGTS ARP+I K +V++A+  GADA+ HGCTGKGNDQVRFEL   A +P++ ++APWR WDI+ RED I YA+  NVP+ +  ++ YS+D+N+WHLSHEG  LEDP
Sbjct:   15 LDTSIIIPWLKENYNCEVIAVCGNVGQK-DELDGLEEKAIKTGASKLYMEDLTKEFVEDYIFPTIQAGAIYEGKYLLGTSFARPLIGKRLVEIAKVEGADAICHGCTGKGNDQVRFELAVKAFDPDMKIIAPWRIWDIKSREDEITYAEARNVPIKINHETNYSKDKNIWHLSHEGLDLEDP 195          
BLAST of CB304754 vs. ExPASy Swiss-Prot
Match: ASSY_CLOB8 (Argininosuccinate synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=argG PE=3 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 9.985e-64
Identity = 111/182 (60.99%), Postives = 144/182 (79.12%), Query Frame = -1
Query:   32 LDTSVIVPWLRENYGCEVVCFTADVGQGIKELDGLEEKAKASGACQLVVKDLKEEFVKDYIFPCLRAGAIYERKYLLGTSMARPVIAKAMVDVAREVGADAVAHGCTGKGNDQVRFELTFFALNPELNVVAPWREWDIQGREDAIEYAKKHNVPVPVTKKSIYSRDRNLWHLSHEGDILEDP 577
            LDTS+I+PWL+ENYGCEV+    +VGQ   ELDGLEEKA  +GA +L ++DL +EFV DYIFP ++AGAIYE KYLLGTS ARP+I K +V++A+  GADA+ HGCTGKGNDQVRFE+   A  PE+ ++APWR WDI+ RED I+YA+  NVP+ + +++ YS+D+N+WHLSHEG  LE P
Sbjct:   15 LDTSIIIPWLKENYGCEVIAVCGNVGQK-DELDGLEEKAIKTGASKLYIEDLTQEFVDDYIFPTIQAGAIYEGKYLLGTSFARPIIGKRLVEIAKAEGADAICHGCTGKGNDQVRFEMAVKAFAPEMPIIAPWRIWDIKSREDEIDYAEAKNVPLKINRETNYSKDKNIWHLSHEGLDLEFP 195          
BLAST of CB304754 vs. ExPASy Swiss-Prot
Match: ASSY_SHESH (Argininosuccinate synthase OS=Shewanella sediminis (strain HAW-EB3) GN=argG PE=3 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 1.304e-63
Identity = 115/183 (62.84%), Postives = 138/183 (75.41%), Query Frame = -1
Query:   32 LDTSVIVPWLRENY-GCEVVCFTADVGQGIKELDGLEEKAKASGACQLVVKDLKEEFVKDYIFPCLRAGAIYERKYLLGTSMARPVIAKAMVDVAREVGADAVAHGCTGKGNDQVRFELTFFALNPELNVVAPWREWDIQGREDAIEYAKKHNVPVPVTKKSIYSRDRNLWHLSHEGDILEDP 577
            LDTS I+PWL+E Y  CE++ F ADVGQG  EL+GL EKA +SGA +  + DLKEE V DYI+P +  GAIYE  YLLGTSMARP+IAKA V+VAR+VGADAV HGCTGKGNDQVRFE  F AL P+L V+APWREW++  RED ++Y  + N+    +   IYSRD N WH+SHEG  LEDP
Sbjct:   21 LDTSAIIPWLKETYDNCEIIAFCADVGQGDAELEGLHEKAISSGASECYIVDLKEELVADYIYPTIATGAIYEGTYLLGTSMARPIIAKAQVEVARKVGADAVCHGCTGKGNDQVRFEGCFAALAPDLKVIAPWREWEMVSREDLLDYLAERNIETTSSVTKIYSRDANAWHISHEGGELEDP 203          
BLAST of CB304754 vs. ExPASy Swiss-Prot
Match: ASSY_SHEB9 (Argininosuccinate synthase OS=Shewanella baltica (strain OS195) GN=argG PE=3 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 1.703e-63
Identity = 116/183 (63.39%), Postives = 141/183 (77.05%), Query Frame = -1
Query:   32 LDTSVIVPWLRENY-GCEVVCFTADVGQGIKELDGLEEKAKASGACQLVVKDLKEEFVKDYIFPCLRAGAIYERKYLLGTSMARPVIAKAMVDVAREVGADAVAHGCTGKGNDQVRFELTFFALNPELNVVAPWREWDIQGREDAIEYAKKHNVPVPVTKKSIYSRDRNLWHLSHEGDILEDP 577
            LDTS I+PWL+ENY  CE++ F ADVGQG +EL GL EKA ASGA +  + DLKEEFVK+YI+P + +GAIYE  YLLGTSMARP+IAKA V+VAR+VGADA+ HGCTGKGNDQVRFE  F AL P+L V+APWREW +Q RED + Y  + ++    +   IYSRD N +H+SHEG  LEDP
Sbjct:   21 LDTSAIIPWLKENYDNCEIIAFCADVGQGEEELVGLTEKALASGASECHIVDLKEEFVKEYIYPTIASGAIYEGTYLLGTSMARPIIAKAQVEVARKVGADALCHGCTGKGNDQVRFEGCFAALAPDLKVIAPWREWTMQSREDLLAYLAERDIKTSASATKIYSRDANAFHISHEGGELEDP 203          
BLAST of CB304754 vs. ExPASy Swiss-Prot
Match: ASSY_SHEB8 (Argininosuccinate synthase OS=Shewanella baltica (strain OS185) GN=argG PE=3 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 1.703e-63
Identity = 116/183 (63.39%), Postives = 141/183 (77.05%), Query Frame = -1
Query:   32 LDTSVIVPWLRENY-GCEVVCFTADVGQGIKELDGLEEKAKASGACQLVVKDLKEEFVKDYIFPCLRAGAIYERKYLLGTSMARPVIAKAMVDVAREVGADAVAHGCTGKGNDQVRFELTFFALNPELNVVAPWREWDIQGREDAIEYAKKHNVPVPVTKKSIYSRDRNLWHLSHEGDILEDP 577
            LDTS I+PWL+ENY  CE++ F ADVGQG +EL GL EKA ASGA +  + DLKEEFVK+YI+P + +GAIYE  YLLGTSMARP+IAKA V+VAR+VGADA+ HGCTGKGNDQVRFE  F AL P+L V+APWREW +Q RED + Y  + ++    +   IYSRD N +H+SHEG  LEDP
Sbjct:   21 LDTSAIIPWLKENYDNCEIIAFCADVGQGEEELVGLTEKALASGASECHIVDLKEEFVKEYIYPTIASGAIYEGTYLLGTSMARPIIAKAQVEVARKVGADALCHGCTGKGNDQVRFEGCFAALAPDLKVIAPWREWTMQSREDLLAYLAERDIKTSASATKIYSRDANAFHISHEGGELEDP 203          
BLAST of CB304754 vs. ExPASy Swiss-Prot
Match: ASSY_SHEB5 (Argininosuccinate synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=argG PE=3 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 1.703e-63
Identity = 116/183 (63.39%), Postives = 141/183 (77.05%), Query Frame = -1
Query:   32 LDTSVIVPWLRENY-GCEVVCFTADVGQGIKELDGLEEKAKASGACQLVVKDLKEEFVKDYIFPCLRAGAIYERKYLLGTSMARPVIAKAMVDVAREVGADAVAHGCTGKGNDQVRFELTFFALNPELNVVAPWREWDIQGREDAIEYAKKHNVPVPVTKKSIYSRDRNLWHLSHEGDILEDP 577
            LDTS I+PWL+ENY  CE++ F ADVGQG +EL GL EKA ASGA +  + DLKEEFVK+YI+P + +GAIYE  YLLGTSMARP+IAKA V+VAR+VGADA+ HGCTGKGNDQVRFE  F AL P+L V+APWREW +Q RED + Y  + ++    +   IYSRD N +H+SHEG  LEDP
Sbjct:   21 LDTSAIIPWLKENYDNCEIIAFCADVGQGEEELVGLTEKALASGASECHIVDLKEEFVKEYIYPTIASGAIYEGTYLLGTSMARPIIAKAQVEVARKVGADALCHGCTGKGNDQVRFEGCFAALAPDLKVIAPWREWTMQSREDLLAYLAERDIKTSASATKIYSRDANAFHISHEGGELEDP 203          
BLAST of CB304754 vs. ExPASy Swiss-Prot
Match: ASSY_SHEB2 (Argininosuccinate synthase OS=Shewanella baltica (strain OS223) GN=argG PE=3 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 1.703e-63
Identity = 116/183 (63.39%), Postives = 141/183 (77.05%), Query Frame = -1
Query:   32 LDTSVIVPWLRENY-GCEVVCFTADVGQGIKELDGLEEKAKASGACQLVVKDLKEEFVKDYIFPCLRAGAIYERKYLLGTSMARPVIAKAMVDVAREVGADAVAHGCTGKGNDQVRFELTFFALNPELNVVAPWREWDIQGREDAIEYAKKHNVPVPVTKKSIYSRDRNLWHLSHEGDILEDP 577
            LDTS I+PWL+ENY  CE++ F ADVGQG +EL GL EKA ASGA +  + DLKEEFVK+YI+P + +GAIYE  YLLGTSMARP+IAKA V+VAR+VGADA+ HGCTGKGNDQVRFE  F AL P+L V+APWREW +Q RED + Y  + ++    +   IYSRD N +H+SHEG  LEDP
Sbjct:   21 LDTSAIIPWLKENYDNCEIIAFCADVGQGEEELVGLTEKALASGASECHIVDLKEEFVKEYIYPTIASGAIYEGTYLLGTSMARPIIAKAQVEVARKVGADALCHGCTGKGNDQVRFEGCFAALAPDLKVIAPWREWTMQSREDLLAYLAERDIKTSASATKIYSRDANAFHISHEGGELEDP 203          
BLAST of CB304754 vs. ExPASy Swiss-Prot
Match: ASSY_SERP5 (Argininosuccinate synthase OS=Serratia proteamaculans (strain 568) GN=argG PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 2.224e-63
Identity = 111/183 (60.66%), Postives = 142/183 (77.60%), Query Frame = -1
Query:   32 LDTSVIVPWLRENYG-CEVVCFTADVGQGIKELDGLEEKAKASGACQLVVKDLKEEFVKDYIFPCLRAGAIYERKYLLGTSMARPVIAKAMVDVAREVGADAVAHGCTGKGNDQVRFELTFFALNPELNVVAPWREWDIQGREDAIEYAKKHNVPVPVTKKSIYSRDRNLWHLSHEGDILEDP 577
            LDTS I+PWL+ENYG CEVV F AD+GQ   +L+G+E+KA  SGA +  V DL+EEF++DY++P L+ GA+YE  YLLGTSMARP+IAKA V++A +VGADAV HG TGKGNDQVRFE T+ AL P L VVAPWREW+++ RE  ++Y K+ N+P   + + IYSRD N WH+S EG +LE P
Sbjct:   17 LDTSAIIPWLKENYGGCEVVAFVADIGQERSDLEGVEQKALQSGASECHVVDLREEFIRDYVYPVLQTGALYEGSYLLGTSMARPIIAKAQVELALKVGADAVCHGATGKGNDQVRFETTYTALAPHLKVVAPWREWNLRSREALLDYLKERNIPTTASLEKIYSRDENAWHISTEGGVLESP 199          
BLAST of CB304754 vs. ExPASy Swiss-Prot
Match: ASSY_PHOLL (Argininosuccinate synthase OS=Photorhabdus luminescens subsp. laumondii GN=argG PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 2.224e-63
Identity = 112/181 (61.88%), Postives = 143/181 (79.01%), Query Frame = -1
Query:   38 LDTSVIVPWLRENYG-CEVVCFTADVGQGIKELDGLEEKAKASGACQLVVKDLKEEFVKDYIFPCLRAGAIYERKYLLGTSMARPVIAKAMVDVAREVGADAVAHGCTGKGNDQVRFELTFFALNPELNVVAPWREWDIQGREDAIEYAKKHNVPVPVTKKSIYSRDRNLWHLSHEGDILE 577
            LDTS I+PWL+E+YG CEVV F ADVGQ  ++L+G+E+KA  SGA +  V DL+EEF+KDY++P L+ GA+YE  YLLGTSMARP+IAKA V++A +VGADA+AHG TGKGNDQVRFE T+ AL P+L VVAPWREWD++ RE  ++Y K  ++P   T + IYSRD N WH+S EG +LE
Sbjct:   17 LDTSAIIPWLKEHYGNCEVVAFVADVGQSREDLEGVEQKALRSGASECHVVDLREEFIKDYVYPVLKTGALYEGSYLLGTSMARPIIAKAQVELALKVGADALAHGATGKGNDQVRFESTYTALAPQLKVVAPWREWDLRSREALLDYLKARDIPTTATLEKIYSRDENAWHISTEGGVLE 197          
BLAST of CB304754 vs. ExPASy Swiss-Prot
Match: ASSY_THET2 (Argininosuccinate synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=argG PE=3 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 2.905e-63
Identity = 110/182 (60.44%), Postives = 145/182 (79.67%), Query Frame = -1
Query:   32 LDTSVIVPWLRENYGCEVVCFTADVGQGIKELDGLEEKAKASGACQLVVKDLKEEFVKDYIFPCLRAGAIYERKYLLGTSMARPVIAKAMVDVAREVGADAVAHGCTGKGNDQVRFELTFFALNPELNVVAPWREWDIQGREDAIEYAKKHNVPVPVTKKSIYSRDRNLWHLSHEGDILEDP 577
            LDTS+I+ WL+E YG EV+ FTAD+GQG +E++   EKA  +GA + +  DLKEEFV+D++FP +RAGA+YE  YLLGTS+ARP+IAK +V +A E GA+A+AHG TGKGNDQVRFELT +AL P++ V+APWREW  QGR++ I YA+ H +PVPVT++  YS D NL H+S+EG +LEDP
Sbjct:   11 LDTSIILKWLKETYGAEVIAFTADIGQG-EEVEEAREKALRTGASKAIALDLKEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKGNDQVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQEKPYSMDANLLHISYEGGVLEDP 191          
The following BLAST results are available for this feature:
BLAST of CB304754 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
ASSY_CLOBA9.985e-6460.99Argininosuccinate synthase OS=Clostridium botulinu... [more]
ASSY_CLOB89.985e-6460.99Argininosuccinate synthase OS=Clostridium beijerin... [more]
ASSY_SHESH1.304e-6362.84Argininosuccinate synthase OS=Shewanella sediminis... [more]
ASSY_SHEB91.703e-6363.39Argininosuccinate synthase OS=Shewanella baltica (... [more]
ASSY_SHEB81.703e-6363.39Argininosuccinate synthase OS=Shewanella baltica (... [more]
ASSY_SHEB51.703e-6363.39Argininosuccinate synthase OS=Shewanella baltica (... [more]
ASSY_SHEB21.703e-6363.39Argininosuccinate synthase OS=Shewanella baltica (... [more]
ASSY_SERP52.224e-6360.66Argininosuccinate synthase OS=Serratia proteamacul... [more]
ASSY_PHOLL2.224e-6361.88Argininosuccinate synthase OS=Photorhabdus lumines... [more]
ASSY_THET22.905e-6360.44Argininosuccinate synthase OS=Thermus thermophilus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IIaR_D09 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IIaR_D09 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304754 ID=CB304754; Name=CB304754; organism=Citrus sinensis; type=EST; length=577bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTAGGATCTTCCAAGATGTCC
CCCTCATGGCTCAAGTGCCATAAATTCCGGTCTCTACTGTATATGGATTT
TTTTGTTACAGGAACAGGCACGTTGTGCTTCTTAGCATATTCAATAGCAT
CTTCTCTTCCCTGAATATCCCATTCCCTCCATGGAGCCACAACATTCAAC
TCAGGATTTAAAGCAAAGAATGTAAGCTCAAAGCGGACCTGGTCATTTCC
TTTTCCTGTGCACCCATGAGCGACAGCATCAGCTCCAACTTCTCTGGCAA
CATCCACCATGGCCTTGGCAATAACGGGGCGGGCCATTGATGTTCCCAGC
AGATACTTTCTCTCATAAATTGCACCAGCTCGCAAGCAAGGAAATATATA
GTCTTTAACAAATTCCTCCTTCAAATCCTTCACCACTAACTGACAAGCTC
CACTAGCCTTGGCCTTCTCTTCCAATCCATCCAATTCCTTGATTCCTTGA
CCAACATCAGCAGTGAAACAAACAACCTCACAACCATAATTCTCCCTTAG
CCATGGCACAATGACTGAAGTGTCTAA
back to top