CF417071

Overview
NameCF417071
Unique NameCF417071
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length662
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF417071_ssr538 microsatellite CF417071_ssr538:538..553. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig10454 contig Csv1_Contig10454:381..1040. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXPA2_ARATH (Expansin-A2 OS=Arabidopsis thaliana GN=EXPA2 PE=2 SV=2)

HSP 1 Score: 228.794 bits (582), Expect = 1.955e-59
Identity = 105/144 (72.92%), Postives = 121/144 (84.03%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTG-WQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQF 430
            N AL N+ GGWCNPP +HFDL++P F  IAQYRAG+VPVA+RRVPC + GGIRFTING+ YF+LVLITNVGGAGD+ AVS+KGS+T  WQ MSRNWGQNWQSNTYL GQSLSF+VT SDGRTV SY+V P  W FG+T+ G QF
Sbjct:  112 NFALANDNGGWCNPPLKHFDLAEPAFLQIAQYRAGIVPVAFRRVPCEKGGGIRFTINGNPYFDLVLITNVGGAGDIRAVSLKGSKTDQWQSMSRNWGQNWQSNTYLRGQSLSFQVTDSDGRTVVSYDVVPHDWQFGQTFEGGQF 255          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXP11_ORYSJ (Expansin-A11 OS=Oryza sativa subsp. japonica GN=EXPA11 PE=2 SV=2)

HSP 1 Score: 228.794 bits (582), Expect = 1.955e-59
Identity = 104/143 (72.73%), Postives = 119/143 (83.22%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQF 430
            N AL  +AGGWCNPP+ HFD+++P F  IAQ RAGVVPV YRRV C ++GGIRFTI GHSYFNLVL+TNVGGAGDV AVS+KGSR+GWQ MS NWG NWQ+   L+GQ LSF VT SDGRTVTS NVAP+GWSFG+T+SG QF
Sbjct:  106 NYALAGDAGGWCNPPRPHFDMAEPAFTRIAQARAGVVPVQYRRVACAKQGGIRFTITGHSYFNLVLVTNVGGAGDVTAVSVKGSRSGWQAMSHNWGANWQNGANLDGQPLSFRVTASDGRTVTSDNVAPSGWSFGQTFSGGQF 248          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXPA7_ORYSJ (Expansin-A7 OS=Oryza sativa subsp. japonica GN=EXPA7 PE=2 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 5.687e-59
Identity = 100/144 (69.44%), Postives = 119/144 (82.64%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQFR 433
            N ALP++ GGWCNPP+ HFDL+ P+F HIA+YRAG+VPV+YRRVPC ++GG+RFTING  YFNLVLITNV GAGD+   S+KG+ TGW PMSRNWGQNWQSN+ L GQ+LSF VT SD RT TS+N APAGW FG+T+ G  FR
Sbjct:  120 NYALPSDNGGWCNPPRPHFDLAMPMFLHIAEYRAGIVPVSYRRVPCRKKGGVRFTINGFRYFNLVLITNVAGAGDIVRASVKGTSTGWMPMSRNWGQNWQSNSVLVGQALSFRVTGSDRRTSTSWNAAPAGWHFGQTFEGKNFR 263          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXPA4_ARATH (Expansin-A4 OS=Arabidopsis thaliana GN=EXPA4 PE=1 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 8.212e-58
Identity = 100/144 (69.44%), Postives = 117/144 (81.25%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQFR 433
            N A P++ GGWCNPP++HFDL+ PVF  IAQYRAG+VPV+YRRVPC +RGGIRFTINGH YFNLVLITNV GAGD+   S+KGSRTGW  +SRNWGQNWQSN  L GQ+LSF VT SD RT TS+N+ P+ W FG+T+ G  FR
Sbjct:  113 NLAQPSDNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRASVKGSRTGWMSLSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNMVPSNWQFGQTFVGKNFR 256          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXP21_ORYSJ (Expansin-A21 OS=Oryza sativa subsp. japonica GN=EXPA21 PE=2 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 8.212e-58
Identity = 99/146 (67.81%), Postives = 122/146 (83.56%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIK---GSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQF 430
            N+ALP + GGWCNPP  HFDLSQP F  IA++++G+VPV+YRRV C R+GG+RFTINGHSYFNLVL++NVGGAGDVHAV++K   G +  WQ M+RNWGQNWQS   L+GQ+LSF VTT D R+V SYNVAPAGW+FG+T++G QF
Sbjct:  118 NHALPGDRGGWCNPPLHHFDLSQPAFLRIARFQSGIVPVSYRRVACRRKGGMRFTINGHSYFNLVLVSNVGGAGDVHAVAVKAGGGRKARWQAMARNWGQNWQSGALLDGQALSFTVTTGDRRSVVSYNVAPAGWAFGQTFTGRQF 263          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXPA6_ORYSJ (Expansin-A6 OS=Oryza sativa subsp. japonica GN=EXPA6 PE=2 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 2.389e-57
Identity = 95/149 (63.76%), Postives = 124/149 (83.22%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTG------WQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQF 430
            N ALP++ GGWCNPP++HFDL++P F  IA++ AG+VPV++RRV C R+GG+RFT+NGH+YFNLVL+TNVGGAGDV ++++KGS +G      WQPMSRNWGQNWQSN YL+G++LSF VT  DGR++T  +VAPAGW FG+T+ G QF
Sbjct:  111 NYALPSDGGGWCNPPRRHFDLAEPAFLRIARHAAGIVPVSFRRVACARKGGVRFTVNGHAYFNLVLVTNVGGAGDVRSLAVKGSGSGSRVGGRWQPMSRNWGQNWQSNAYLDGKALSFRVTAGDGRSLTCADVAPAGWQFGQTFEGRQF 259          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXPA1_ORYSJ (Expansin-A1 OS=Oryza sativa subsp. japonica GN=EXPA1 PE=2 SV=2)

HSP 1 Score: 218.394 bits (555), Expect = 2.642e-56
Identity = 94/142 (66.20%), Postives = 119/142 (83.80%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQ 427
            N ALPN+AGGWCNPP+QHFD+++P +  I  Y  G+VPV Y+RVPC ++GG+RFTING  YF LVL++NVGG G + +VSIKGSRTGW  MSRNWG NWQSN YL+GQSLSF+VT+SDG+T+T  +VAPAGW+FG+T+S +Q
Sbjct:  117 NYALPNDAGGWCNPPRQHFDMAEPAWLKIGVYVGGIVPVMYQRVPCAKQGGVRFTINGRDYFELVLVSNVGGVGSIQSVSIKGSRTGWMAMSRNWGVNWQSNAYLDGQSLSFKVTSSDGQTLTFLDVAPAGWTFGQTFSTSQ 258          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXP16_ARATH (Expansin-A16 OS=Arabidopsis thaliana GN=EXPA16 PE=2 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 2.642e-56
Identity = 96/144 (66.67%), Postives = 116/144 (80.56%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQFR 433
            N A P++ GGWCNPP+ HFDL+ PVF  IA+YRAG+VP++YRRV C + GGIRFTINGH YFNLVLITNV GAGD+   S+KGS+TGW  ++RNWGQNWQSN  L GQSLSF VT+SD RT TS+N+AP+ W FG+T+ G  FR
Sbjct:  116 NLAQPSDNGGWCNPPRSHFDLAMPVFLKIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDIARTSVKGSKTGWMSLTRNWGQNWQSNAVLVGQSLSFRVTSSDRRTSTSWNIAPSNWQFGQTFVGKNFR 259          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXPA3_ARATH (Expansin-A3 OS=Arabidopsis thaliana GN=EXPA3 PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.311e-55
Identity = 97/144 (67.36%), Postives = 116/144 (80.56%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQFR 433
            N A P++ GGWCNPP++HFDL+ P+F  I  YRAG+VPV+YRRVPC + GGIRFT+NG  YFNLVL+TNV GAGD++ VS+KGS+T W  MSRNWGQNWQSN  L GQSLSF VT SD R+ TS+NVAPA W FG+T+SG  FR
Sbjct:  118 NFAQPSDDGGWCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNLVLVTNVAGAGDINGVSVKGSKTDWVRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTSWNVAPATWQFGQTFSGKNFR 261          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXPA9_ARATH (Expansin-A9 OS=Arabidopsis thaliana GN=EXPA9 PE=2 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 6.507e-55
Identity = 94/136 (69.12%), Postives = 112/136 (82.35%), Query Frame = 2
Query:   26 GGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQFR 433
            GGWCNPP++HFDL+ P+F  IA+Y+AG+VPV+YRR+PC ++GGIRFTING  YFNLVL+TNV GAGDV  VS+KGS T W  +SRNWGQNWQSN  L GQSLSF V TSDGR+ TS N+AP+ W FG+TYSG  FR
Sbjct:  122 GGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKYFNLVLVTNVAGAGDVIKVSVKGSNTQWLDLSRNWGQNWQSNALLVGQSLSFRVKTSDGRSSTSNNIAPSNWQFGQTYSGKNFR 257          
The following BLAST results are available for this feature:
BLAST of CF417071 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
EXPA2_ARATH1.955e-5972.92Expansin-A2 OS=Arabidopsis thaliana GN=EXPA2 PE=2 ... [more]
EXP11_ORYSJ1.955e-5972.73Expansin-A11 OS=Oryza sativa subsp. japonica GN=EX... [more]
EXPA7_ORYSJ5.687e-5969.44Expansin-A7 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXPA4_ARATH8.212e-5869.44Expansin-A4 OS=Arabidopsis thaliana GN=EXPA4 PE=1 ... [more]
EXP21_ORYSJ8.212e-5867.81Expansin-A21 OS=Oryza sativa subsp. japonica GN=EX... [more]
EXPA6_ORYSJ2.389e-5763.76Expansin-A6 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXPA1_ORYSJ2.642e-5666.20Expansin-A1 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXP16_ARATH2.642e-5666.67Expansin-A16 OS=Arabidopsis thaliana GN=EXPA16 PE=... [more]
EXPA3_ARATH1.311e-5567.36Expansin-A3 OS=Arabidopsis thaliana GN=EXPA3 PE=2 ... [more]
EXPA9_ARATH6.507e-5569.12Expansin-A9 OS=Arabidopsis thaliana GN=EXPA9 PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_115000-001 Citrus sinensis: Insect-damaged immature leaves/stems from field collected Valencia orange Citrus sinensis cDNA clone IDFL-001_A1 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF417071 ID=CF417071|Name=CF417071|organism=Citrus sinensis|type=EST|length=662bp
GAACAACGCCCTTCCCAACAATGCAGGCGGTTGGTGCAATCCTCCGCAGC
AACATTTTGATCTCTCTCAGCCTGTGTTCCAACACATTGCTCAATACAGA
GCTGGAGTTGTCCCTGTAGCTTACAGGAGGGTACCCTGCGGAAGAAGGGG
AGGCATCAGGTTCACAATCAATGGCCATTCCTACTTCAACCTAGTGTTGA
TCACCAACGTTGGTGGTGCTGGTGATGTTCATGCTGTTTCAATCAAAGGA
TCTAGAACTGGCTGGCAGCCAATGTCAAGAAACTGGGGCCAAAACTGGCA
AAGCAACACTTATCTCAATGGCCAAAGCCTGTCATTTGAGGTCACCACAA
GCGATGGCCGTACTGTGACTTCCTACAATGTTGCCCCTGCTGGCTGGTCC
TTTGGCCGAACTTACTCCGGTGCTCAATTCCGCTAGAGCCACCAAGACCA
TTAGNAGATTGGGTTTTAACACCTTTTTTAGCTATATATTCGTGTACTAA
GTAGTATATTTTAGTATGAAATTTTAGCATACTAGGGTATATATATATAT
ATATNAATATAGAAGTAGCTATGTGGCTAGTTTTTGGCTTCCAGGGTCAA
AAATGAAAAAAAAGGGCTTATTTTAAAATGGCTTATTTTTTTCATTTTCA
TTGATTTTTATG
back to top