CF417087
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF417087 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDO (Non-specific lipid-transfer protein 1 OS=Prunus domestica PE=1 SV=1) HSP 1 Score: 48.9062 bits (115), Expect = 2.780e-11 Identity = 23/50 (46.00%), Postives = 33/50 (66.00%), Query Frame = 3 Query: 15 QVTASLXPCIPFLKTGGRFSPPPCCXGVQSLNGADXNXPPXRRAACNCLE 164 QV+++L PCI ++K GG PP CC G++++N RRAACNCL+ Sbjct: 5 QVSSNLAPCINYVKGGGAV-PPACCNGIRNVNNL-ARTTADRRAACNCLK 52 HSP 2 Score: 40.0466 bits (92), Expect = 2.780e-11 Identity = 17/31 (54.84%), Postives = 21/31 (67.74%), Query Frame = 1 Query: 163 KRAYGTIRGIKPNVAAGLPSXCGVRIPYXIS 255 K+ G+I G+ PN AA LP CGV +PY IS Sbjct: 52 KQLSGSIPGVNPNNAAALPGKCGVNVPYKIS 82
BLAST of CF417087 vs. ExPASy Swiss-Prot
Match: NLTP1_LENCU (Non-specific lipid-transfer protein 1 OS=Lens culinaris PE=3 SV=1) HSP 1 Score: 49.6766 bits (117), Expect = 3.559e-11 Identity = 26/51 (50.98%), Postives = 33/51 (64.71%), Query Frame = 3 Query: 18 VTASLXPCIPFLKTGGRFSPPPCCXGVQSLNGADXNXPPXRRAACNCLETS 170 V+ +L PC+ +LK GG P CC GV+ LNGA RRAACNCL++S Sbjct: 32 VSGALVPCLTYLK-GGPGPSPQCCGGVKRLNGA-ARTTIDRRAACNCLKSS 80 HSP 2 Score: 38.891 bits (89), Expect = 3.559e-11 Identity = 17/31 (54.84%), Postives = 21/31 (67.74%), Query Frame = 1 Query: 163 KRAYGTIRGIKPNVAAGLPSXCGVRIPYXIS 255 K + G+I G+KP A LP CGVR+PY IS Sbjct: 78 KSSAGSISGLKPGNVATLPGKCGVRLPYTIS 108 The following BLAST results are available for this feature:
BLAST of CF417087 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF417087 ID=CF417087; Name=CF417087; organism=Citrus sinensis; type=EST; length=485bpback to top |