CF504045
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CF504045 vs. ExPASy Swiss-Prot
Match: CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 61.6178 bits (148), Expect = 1.124e-13 Identity = 29/64 (45.31%), Postives = 39/64 (60.94%), Query Frame = 3 Query: 153 QKENALLXXXXXXXXXXXXXXGTMHHLTVEAIDAGRKKLYEAKVWVKPWLNFKDLQEFKHVGDS 344 +K N+LL GT+++ T+E + KKLYEAKVW KPW++FK+LQEFK V S Sbjct: 74 KKANSLLEFEKLVSVKQQVVAGTLYYFTIEVKEGDAKKLYEAKVWEKPWMDFKELQEFKPVDAS 137 HSP 2 Score: 33.8834 bits (76), Expect = 1.124e-13 Identity = 18/31 (58.06%), Postives = 21/31 (67.74%), Query Frame = 1 Query: 67 LLGGVQESRGAENSNEIESLARFAIEEHNKK 159 +LGGV E G EN + LARFA+ EHNKK Sbjct: 46 VLGGV-EPVGNENDLHLVDLARFAVTEHNKK 75
BLAST of CF504045 vs. ExPASy Swiss-Prot
Match: CYT1_ARATH (Cysteine proteinase inhibitor 1 OS=Arabidopsis thaliana GN=CYS1 PE=1 SV=2) HSP 1 Score: 53.5286 bits (127), Expect = 2.035e-12 Identity = 24/42 (57.14%), Postives = 27/42 (64.29%), Query Frame = 3 Query: 216 GTMHHLTVEAIDAGRKKLYEAKVWVKPWLNFKDLQEFKHVGD 341 GTMHHLTVE D K+YEAKV K W N K L+ F H+ D Sbjct: 59 GTMHHLTVEVADGETNKVYEAKVLEKAWENLKQLESFNHLHD 100 HSP 2 Score: 37.7354 bits (86), Expect = 2.035e-12 Identity = 16/34 (47.06%), Postives = 24/34 (70.59%), Query Frame = 1 Query: 67 LLGGVQESRGAENSNEIESLARFAIEEHNKKRML 168 ++GGV++ N ++ESLARFA++EHNK L Sbjct: 9 IVGGVRDIDANANDLQVESLARFAVDEHNKNENL 42 The following BLAST results are available for this feature:
BLAST of CF504045 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF504045 ID=CF504045; Name=CF504045; organism=Citrus sinensis; type=EST; length=549bpback to top |