CF832535

Overview
NameCF832535
Unique NameCF832535
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length651
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRF_LEPCP (Ribosome-recycling factor OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=frr PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 4.896e-31
Identity = 65/143 (45.45%), Postives = 101/143 (70.63%), Query Frame = -2
Query:  222 SNPAMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSI 650
            ++P +LD++ V+YYGS + L  +A +   D+ ++ +QP++KS  + IEKAI  SDLG+ P++ G++IR+ +P LT ERRKEL+KVV    E+ KVAVRN+RRDA    +KL K+K +SED+ +    ++QKLTD  + +ID +
Sbjct:   33 AHPGILDQVHVDYYGSNLPLSQVANVTLIDARTISVQPWEKSMAQKIEKAIRESDLGLNPSSMGDLIRVPMPALTEERRKELTKVVRHAGEDSKVAVRNLRRDANDQAKKLLKDKLISEDDERRSVDEVQKLTDRVIAEIDRL 175          
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRF_JANMA (Ribosome-recycling factor OS=Janthinobacterium sp. (strain Marseille) GN=frr PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 4.896e-31
Identity = 63/143 (44.06%), Postives = 99/143 (69.23%), Query Frame = -2
Query:  222 SNPAMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSI 650
            ++  +LD + VEYYG+P +L  +A +   D+ ++ +QP++K  +  +EKAI  +DLG+ P   GE+IR+  P LT ERRKE+ K+V  +AE+ K+AVRNIRRDA ++ +KL KEK  SED  +    ++QKLTD+++ +ID +
Sbjct:   33 AHTGILDHVMVEYYGNPTNLSQVANVTLIDARTIGVQPFEKKMVAVVEKAIREADLGLNPATQGELIRVPTPPLTEERRKEMVKLVKSEAEDAKIAVRNIRRDANESLKKLVKEKACSEDEERRAQDEIQKLTDKFVIEIDKL 175          
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRF_HELPH (Ribosome-recycling factor OS=Helicobacter pylori (strain HPAG1) GN=frr PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 4.896e-31
Identity = 63/141 (44.68%), Postives = 99/141 (70.21%), Query Frame = -2
Query:  216 MLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIYK 638
            +LD I+V+YYG+P +L  +  + + D+++L I P++K+ LK IE++I  +++G+ PNNDGE I+L  P +T+E+RK ++K      E+ KVAVRNIR+DA    +KL+K+K++SED  K     +QK+TDE +KKID   K
Sbjct:   36 ILDHIKVDYYGTPTALNQVGSVMSLDATTLQISPWEKNLLKEIERSIQEANIGVNPNNDGETIKLFFPPMTTEQRKLIAKDAKAMGEKAKVAVRNIRQDANNKVKKLEKDKEISEDESKKAQEQIQKITDEAIKKIDESVK 176          
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRF_DESAH (Ribosome-recycling factor OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=frr PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 4.896e-31
Identity = 60/140 (42.86%), Postives = 101/140 (72.14%), Query Frame = -2
Query:  219 MLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIY 638
            MLD ++V+YYG+   L  +A I  P+S  + +QP+D S++K +EK I+ +++G+TP++DG++IR+T+P LT +RR+E++K V    EE KVAVRNIRRD+    + LQK+  +SED       ++Q +TDE++K+I++++
Sbjct:   36 MLDGVKVDYYGTLTPLNQMASIAIPESRMITVQPWDISAIKEVEKGILKANIGLTPSSDGKIIRITIPPLTEDRRREIAKTVHNTCEEFKVAVRNIRRDSNDTLKSLQKDGDISEDENFKAQKEVQDITDEFIKQIEAVF 175          
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRF_BURM1 (Ribosome-recycling factor OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=frr PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 4.896e-31
Identity = 61/143 (42.66%), Postives = 103/143 (72.03%), Query Frame = -2
Query:  222 SNPAMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSI 650
            ++  +LD ++V+YYGS V +  +A +   D+ ++ +QP++K+ +  +EKAI  +DLG+ P   G++IR+ +P LT ERR+EL+KVV  + E  KVA+RN+RRDA +A +KL K+K++SED+ +    D+QKLTD+++ +ID +
Sbjct:   33 AHTGLLDHVQVDYYGSMVPISQVANLTLVDARTIGVQPWEKNMVAKVEKAIREADLGLNPATAGDLIRVPMPPLTEERRRELTKVVKGEGETAKVAIRNLRRDANEALKKLVKDKEISEDDERRAGDDVQKLTDKHVAEIDKL 175          
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRF_BORT9 (Ribosome-recycling factor OS=Borrelia turicatae (strain 91E135) GN=frr PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 4.896e-31
Identity = 63/143 (44.06%), Postives = 101/143 (70.63%), Query Frame = -2
Query:  219 NPAMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIY 647
            N ++ DK+ V+YYG    L  +A ++ P++  ++IQP+DKS L  IE+AI+SSDL M P++DG V+R+ +P LT ERRKE+ K   K AEE KVA RN+R++     +K +K+ +++ED+++ +  D+Q+ T+ Y+KKID I+
Sbjct:   32 NSSLFDKVLVDYYGEKTPLTRVANVSIPEARLIVIQPWDKSLLSKIEQAILSSDLSMNPSSDGAVLRIKVPVLTVERRKEIVKQAKKIAEEYKVAARNVRQELNSKAKKQEKDSQITEDDLRRILDDIQRDTNSYIKKIDEIF 174          
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRF_BORHD (Ribosome-recycling factor OS=Borrelia hermsii (strain DAH) GN=frr PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 4.896e-31
Identity = 64/141 (45.39%), Postives = 100/141 (70.92%), Query Frame = -2
Query:  219 AMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIY 641
            A+ DK+ V+YYG    L  +A I+ P++  ++IQP+DKS L  IE+AI+SSDL M P++DG V+R+ +P LT ERRKE+ K   K AEE KVA RN+R++     +K +K+ +++ED+++ +  D+Q+ T+ Y+KKID I+
Sbjct:   34 ALFDKVLVDYYGEKTPLTRVANISIPEARLIVIQPWDKSLLSKIEQAILSSDLSMNPSSDGSVLRIKVPVLTVERRKEIVKQAKKIAEEYKVAARNVRQELNNKAKKQEKDSQITEDDLRRILDDIQRDTNSYIKKIDEIF 174          
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRF_SALRD (Ribosome-recycling factor OS=Salinibacter ruber (strain DSM 13855) GN=frr PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.395e-31
Identity = 58/146 (39.73%), Postives = 101/146 (69.18%), Query Frame = -2
Query:  213 SNPAMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIYKQ 650
            ++PAML+ + VEYYGS   L+ +A ++ P    +++QP+D++++++IE+ I+ +DLG+ PNNDGE IR+ +P L+ ERRKEL +   ++AEE K+++RNIRRDA    + + + +  SED +     DLQ +TD + + ++ + +Q
Sbjct:   36 ASPAMLENVTVEYYGSQTPLEQVASVSAPQPDLIVVQPFDRNAIENIERGIMKADLGLNPNNDGEKIRIPIPPLSEERRKELVETSRERAEETKISIRNIRRDAKNEIQNVVEAENFSEDVLYGAEEDLQDITDAHTETVEGLLEQ 181          
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRF_RICCK (Ribosome-recycling factor OS=Rickettsia canadensis (strain McKiel) GN=frr PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 8.352e-31
Identity = 65/142 (45.77%), Postives = 97/142 (68.31%), Query Frame = -2
Query:  213 MLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIYKQ 638
            +LD + VE YGS + L  +A I+TPD+ ++ +Q +DKS +  +EK I  ++LG+TP  DG++IRL +P LT ERRKEL K+  K  E+ K+++RNIRRD  +  +KL+K   L++D    LS  +QKLT++Y  K+DS  KQ
Sbjct:   37 LLDSVIVEAYGSKIPLSQVASISTPDARTINVQVWDKSMVSLVEKGITIANLGLTPATDGQLIRLPIPILTEERRKELVKLAHKYGEDTKISLRNIRRDGNEELKKLEKNNILTKDEHHSLSEQVQKLTNDYSNKVDSAIKQ 178          
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRF_POLSJ (Ribosome-recycling factor OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=frr PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 8.352e-31
Identity = 62/143 (43.36%), Postives = 97/143 (67.83%), Query Frame = -2
Query:  222 SNPAMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSI 650
            +NP +LD + V+YYGS V +  +A ++  D+ ++ + P++K     IEKAI  SDLG+ P   G++IR+ +P +T ERRKEL+KVV  + E  KVAVRN+RRDA +  +KL KEK +SED+ +    ++QK TD ++ ++D +
Sbjct:   33 ANPGLLDTVHVDYYGSMVPISQVANVSLLDARTISVSPWEKGMGAKIEKAIRDSDLGLNPAAQGDLIRVPMPAMTEERRKELTKVVRAEGEHAKVAVRNLRRDANEGVKKLLKEKLVSEDDERRAQDEIQKFTDRFIAEVDKL 175          
The following BLAST results are available for this feature:
BLAST of CF832535 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RRF_LEPCP4.896e-3145.45Ribosome-recycling factor OS=Leptothrix cholodnii ... [more]
RRF_JANMA4.896e-3144.06Ribosome-recycling factor OS=Janthinobacterium sp.... [more]
RRF_HELPH4.896e-3144.68Ribosome-recycling factor OS=Helicobacter pylori (... [more]
RRF_DESAH4.896e-3142.86Ribosome-recycling factor OS=Desulfobacterium auto... [more]
RRF_BURM14.896e-3142.66Ribosome-recycling factor OS=Burkholderia multivor... [more]
RRF_BORT94.896e-3144.06Ribosome-recycling factor OS=Borrelia turicatae (s... [more]
RRF_BORHD4.896e-3145.39Ribosome-recycling factor OS=Borrelia hermsii (str... [more]
RRF_SALRD6.395e-3139.73Ribosome-recycling factor OS=Salinibacter ruber (s... [more]
RRF_RICCK8.352e-3145.77Ribosome-recycling factor OS=Rickettsia canadensis... [more]
RRF_POLSJ8.352e-3143.36Ribosome-recycling factor OS=Polaromonas sp. (stra... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_02A06_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa02A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832535 ID=CF832535; Name=CF832535; organism=Citrus sinensis; type=EST; length=651bp
TTTTTTTTTTTTTTTTTACAAAGAGTCTAGAATAACTAATTTCCCCCTTT
CATTTCATAACAAAATATCCACCCGTGTCTCCCATTATTATCAAAAAATG
CCATTCTATGGGCAAACCAAAAAATAAAGAGTGCATTCTGAGATTCACTA
GAGAGCTCACCCTTACATTTGTGTGTAAACAATCATTAAACCTTCAACAA
CTCCTTCTCTTTCTGTTTGTAGATGCTATCAATCTTCTTCATATACTCAT
CTGTTAGTTTCTGTAAATCACTTGACAAGTCCTTCACATTGTCTTCAGAG
AGCTTCTTCTCCTTCTGAAGTTTTTCATAAGCTTTTAACGCATCTCTTCT
TATATTCCTAACTGCCACCTTCCCTTCTTCAGCCTGTTTGGCCACAACCT
TTGACAGTTCCTTCCTCCTTTCGGATGTCAATTGAGGAAGGGTTAACCGT
ATGACTTCACCATCATTGTTTGGGGTCATGCCAAGATCAGAGCTCACTAT
GGCCTTCTCTATAGACTTTAAGCTGGATTTGTCATATGGTTGAATCAATA
GAGAACTTGAATCAGGGGTATTGATTTGAGCTATGCTCTTCAAACTTACT
GGGCTTCCATAGTATTCCACCTCAATCTTATCTAGCATAGCTGGATTCGA
T
back to top