CF834600

Overview
NameCF834600
Unique NameCF834600
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length870
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF834600 vs. ExPASy Swiss-Prot
Match: RL17_YARLI (60S ribosomal protein L17 OS=Yarrowia lipolytica GN=RPL17 PE=3 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 1.077e-43
Identity = 97/173 (56.07%), Postives = 114/173 (65.90%), Query Frame = -2
Query:  234 MVKYSKEPDNPTKSCKARGSDLRVHFKNTRETAHAIRKLPLTKAKRYLEDVMAHKQAIPFTRFCGGVGRTAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELTLSXXXXXXXXXXETQLATSKSKK 752
            M +YS +  +PTK+  ARG+ LR  FKNT E A AIR   L KA  YL+ V  HK+AIPF +  G +GRT Q K      + RWPVKS KF+ DLL+NA++NAE KGLD + L ISHIQVNQA KQRRRTYRAHGRIN Y SSP HIEL LS          ET LA   S++
Sbjct:    1 MTRYSVQSVDPTKTASARGAYLRTSFKNTYEVAGAIRGWNLQKALAYLDQVTDHKRAIPFRKHAGSIGRTGQGKEFGVT-KARWPVKSIKFVQDLLQNAQANAETKGLDKETLVISHIQVNQAPKQRRRTYRAHGRINAYQSSPSHIELILSEPAEEIAKAKETSLAHISSRQ 172          
BLAST of CF834600 vs. ExPASy Swiss-Prot
Match: RL22_METBU (50S ribosomal protein L22P OS=Methanococcoides burtonii (strain DSM 6242) GN=rpl22p PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.373e-21
Identity = 60/151 (39.74%), Postives = 89/151 (58.94%), Query Frame = -2
Query:  297 VKYSKEPDNPTKSCKARGSDLRVHFKNTRETAHAIRKLPLTKAKRYLEDVMAHKQAIPFTRFCGGVGRTAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELTLS 749
            +KY+ E D  T S KA GS+L +  K +RE   AI+ +    A++YLEDV+  KQA+PF R    +G       + P   GR+PVK A  +L LLKNAESNAE KGL+ + ++I+H  +N+ +       RA GR +P  +   ++E+ +S
Sbjct:    4 IKYTTELDAET-SAKAMGSELHISPKKSRELCKAIKGMRTNAARQYLEDVVILKQAVPFGRHNDSLGH-----RKGPMAAGRYPVKVASEMLKLLKNAESNAEYKGLNPEHMFIAHTAMNRGRVIHGMRPRARGRASPENTETVNLEMIIS 148          
BLAST of CF834600 vs. ExPASy Swiss-Prot
Match: RL22_METBF (50S ribosomal protein L22P OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl22p PE=3 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 5.753e-21
Identity = 60/151 (39.74%), Postives = 89/151 (58.94%), Query Frame = -2
Query:  297 VKYSKEPDNPTKSCKARGSDLRVHFKNTRETAHAIRKLPLTKAKRYLEDVMAHKQAIPFTRFCGGVGRTAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELTLS 749
            + YS + D  T S KA GS+L +  K +RE    I+ + + +A+++LEDV+A KQA+PF R   G G       + P   GR+PV ++K IL +L+NAESNAE KGL+   +YI+H  + + +  R    RA GR  P  +   +IE+ LS
Sbjct:    4 INYSVKEDPETTS-KAMGSELHISPKKSREVCCKIKGMKVPEARKFLEDVIALKQAVPFKRHHDGSGH-----RKGPMAAGRYPVSASKEILKILRNAESNAEYKGLEPANMYITHAAIQRGRVIRGFMPRARGRATPKDTETVNIEMILS 148          
BLAST of CF834600 vs. ExPASy Swiss-Prot
Match: RL22_IGNH4 (50S ribosomal protein L22P OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rpl22p PE=3 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 5.753e-21
Identity = 56/140 (40.00%), Postives = 79/140 (56.43%), Query Frame = -2
Query:  306 NPTKSCKARGSDLRVHFKNTRETAHAIRKLPLTKAKRYLEDVMAHKQAIPFTRFCGGVGRTAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIEL 725
            NP K+ KA   D  +  K   E A  IR + LT+AK YLE V+  ++ +P+ R+ G V       ++H    GR+PVK+AK+ L LLKN E+NAE KGL+V+ L I HI  ++    +R   RA GR  P      H+E+
Sbjct:   14 NPEKTAKAMMWDAPISPKEATELARVIRGMKLTEAKAYLERVIKMEEPVPYRRYHGKVAHKRGLADKHGIPMGRYPVKAAKYFLKLLKNVEANAEFKGLEVEKLKIVHIASHKGMTIKRWMPRAFGRATPEFERRTHLEV 153          
BLAST of CF834600 vs. ExPASy Swiss-Prot
Match: RL22_METMA (50S ribosomal protein L22P OS=Methanosarcina mazei GN=rpl22p PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.282e-20
Identity = 59/151 (39.07%), Postives = 87/151 (57.62%), Query Frame = -2
Query:  297 VKYSKEPDNPTKSCKARGSDLRVHFKNTRETAHAIRKLPLTKAKRYLEDVMAHKQAIPFTRFCGGVGRTAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELTLS 749
            + YS   D P  + KA GS+L +  K +RE    I+ +  ++A+++LEDV+A KQA+PF R   G G       + P   GR+PV ++K IL +LKNAESNAE KGL+   +YI H  + + +       RA GR +P  +   +IE+ LS
Sbjct:    4 INYSINAD-PENTSKAMGSELHISPKKSREVCCKIKGMKASEARKFLEDVIAMKQAVPFKRHSEGAGH-----RKGPMAGGRYPVSASKEILKVLKNAESNAEYKGLEPANMYIIHAAIQRGRVIHGFMPRARGRASPKDTETVNIEMILS 148          
BLAST of CF834600 vs. ExPASy Swiss-Prot
Match: RL22_METS3 (50S ribosomal protein L22P OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl22p PE=3 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.855e-20
Identity = 58/153 (37.91%), Postives = 89/153 (58.17%), Query Frame = -2
Query:  300 ATMVKYSKEPDNPTKSCKARGSDLRVHFKNTRETAHAIRKLPLTKAKRYLEDVMAHKQAIPFTRFCGGVGRTAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELTL 758
            A    Y+KE  N  K+ +A    L++  K+  E  +AIR + +TKAK YLEDV+  K+++PF R    VG     K +     GR+PVK+A+ +L +L+NAE+NAE KG+D + L+I HI  ++         RA GR+ P+ +   HI++ L
Sbjct:    2 ANKYAYNKET-NEAKTARAMAKSLKISPKHCVEICNAIRGMEVTKAKNYLEDVIDMKKSVPFKRHNRQVGHR---KGQEGWAAGRYPVKAAEQVLKVLENAEANAEYKGMDTENLFIEHISSHRGVVLPGVIPRAFGRMTPFNTPTTHIQIVL 150          
BLAST of CF834600 vs. ExPASy Swiss-Prot
Match: RL22_ARCFU (50S ribosomal protein L22P OS=Archaeoglobus fulgidus GN=rpl22p PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 6.361e-20
Identity = 56/148 (37.84%), Postives = 84/148 (56.76%), Query Frame = -2
Query:  306 VKYSKEPDNPTKSCKARGSDLRVHFKNTRETAHAIRKLPLTKAKRYLEDVMAHKQAIPFTRFCGGVGRTAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIEL 749
            V Y+ +P++ TK+ KA G ++ + FK+  E   AIR   + +A++ LEDV+  K+AIPF R      + A  +       GR+P K+AK++L +L+N E+NAE KGLDV+ L I H Q  + +   R   RA GR  P       +EL
Sbjct:    6 VNYAYKPEDETKAAKAMGYEMPISFKHAVEICRAIRGKKIEEARKLLEDVVEMKRAIPFKRH---KKKVAHRRGLEKWYAGRYPQKAAKYVLKVLRNLEANAEYKGLDVENLVIVHAQAQKGRVIERYMPRAFGRATPRFQQLTTVEL 150          
BLAST of CF834600 vs. ExPASy Swiss-Prot
Match: RL22_PYRKO (50S ribosomal protein L22P OS=Pyrococcus kodakaraensis GN=rpl22p PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.157e-19
Identity = 58/148 (39.19%), Postives = 80/148 (54.05%), Query Frame = -2
Query:  300 YSKEPDNPTKSCKARGSDLRVHFKNTRETAHAIRKLPLTKAKRYLEDVMAHKQAIPFTRFCGGVGRTAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELTL 743
            YS +  +P +  +A G DLR+  K++ E    IR + L  A RYL+DV+A K+ +P  RF    G     K     G GR+PVK AK +  +L NA++NAE KGLDVD L I H   ++    R    RA GR  P+     HIE+ +
Sbjct:    8 YSFQNFDPERMARASGRDLRISPKHSVELLREIRGMMLNDALRYLDDVIAKKRPVPMKRFNDSQGH----KPGKGFGPGRYPVKVAKAVKKILLNAKNNAEQKGLDVDRLKIIHAAAHRGPVLRGYIPRAFGRATPFNEQTTHIEIVV 151          
BLAST of CF834600 vs. ExPASy Swiss-Prot
Match: RL22_METAC (50S ribosomal protein L22P OS=Methanosarcina acetivorans GN=rpl22p PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.157e-19
Identity = 57/151 (37.75%), Postives = 86/151 (56.95%), Query Frame = -2
Query:  297 VKYSKEPDNPTKSCKARGSDLRVHFKNTRETAHAIRKLPLTKAKRYLEDVMAHKQAIPFTRFCGGVGRTAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELTLS 749
            + YS   D  T S KA GS+L +  K +RE    I+ +  ++A+++LEDV+A KQA+PF +   G G       + P   G++P+ ++K IL +LKNAESNAE KGL+   +YI H  + + +       RA GR  P  +   +IE+ LS
Sbjct:    4 INYSINGDPETTS-KAMGSELHISPKKSREVCCKIKGMKASEARKFLEDVIAMKQAVPFKKHHDGSGH-----RKGPMAAGKYPISASKEILKVLKNAESNAEYKGLEPANMYIIHAAIQRGRVIHGFMPRARGRATPKDTETVNIEMILS 148          
BLAST of CF834600 vs. ExPASy Swiss-Prot
Match: RL22_METST (50S ribosomal protein L22P OS=Methanosphaera stadtmanae (strain DSM 3091) GN=rpl22p PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.200e-18
Identity = 58/148 (39.19%), Postives = 82/148 (55.41%), Query Frame = -2
Query:  300 YSKEPDNPTKSCKARGSDLRVHFKNTRETAHAIRKLPLTKAKRYLEDVMAHKQAIPFTRFCGGVGRTAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELTL 743
            YS +P    K  KA G  L++  K++ E    IR + L  AK +LEDV+A K  +PF R    VG  +  K       GR+PVK+A  IL +L+NAE+NAE + LDV+ L + H+  N+    R  T RA GR +P  +   HI++ L
Sbjct:    7 YSYQPKADEKIAKAAGHSLKISPKHSVEICRTIRNMYLEDAKAFLEDVIAKKTVVPFKRHNKKVGHRSDLKGWP---SGRYPVKAAAAILKVLENAEANAENEELDVENLKLVHVCANRGVIIRGWTPRAFGRASPSNTPTTHIQIVL 151          
The following BLAST results are available for this feature:
BLAST of CF834600 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 89
Match NameE-valueIdentityDescription
RL17_YARLI1.077e-4356.0760S ribosomal protein L17 OS=Yarrowia lipolytica G... [more]
RL22_METBU3.373e-2139.7450S ribosomal protein L22P OS=Methanococcoides bur... [more]
RL22_METBF5.753e-2139.7450S ribosomal protein L22P OS=Methanosarcina barke... [more]
RL22_IGNH45.753e-2140.0050S ribosomal protein L22P OS=Ignicoccus hospitali... [more]
RL22_METMA1.282e-2039.0750S ribosomal protein L22P OS=Methanosarcina mazei... [more]
RL22_METS32.855e-2037.9150S ribosomal protein L22P OS=Methanobrevibacter s... [more]
RL22_ARCFU6.361e-2037.8450S ribosomal protein L22P OS=Archaeoglobus fulgid... [more]
RL22_PYRKO3.157e-1939.1950S ribosomal protein L22P OS=Pyrococcus kodakarae... [more]
RL22_METAC3.157e-1937.7550S ribosomal protein L22P OS=Methanosarcina aceti... [more]
RL22_METST1.200e-1839.1950S ribosomal protein L22P OS=Methanosphaera stadt... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_05M23_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa05M23, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834600 ID=CF834600; Name=CF834600; organism=Citrus sinensis; type=EST; length=870bp
TTTTTTTTTTTTTAAGCTTGAAAGTCTTTAATTTTCATAAAGCCCCTACA
GTATGACTGAGGATTCTAACAAAACAGTAAACTGGACTTAATATGAAATA
AACAAAATATGATGTCTGATTTGACTAAATAACATCTCAGTCACTATTAA
AGGTAAAAAAACTCACTTCATCAAGAACACAAAATAGAAAATCAATGCAC
TCTCCAATTGCTATGCTAAACCTCAGACAATTACTTCTTTGATTTGCTAG
TTGCCAACTGGGTCTCAGGCTCTTTCTTTACTGGCTCTTCCTTTTCAGAT
AAGGTCAACTCAATATGGCAGGGAGAGGACATGTAAGGATTAATTCTTCC
ATGAGCACGGTATGTGCGGCGCCTTTGCTTTTGTGCCTGGTTGACTTGGA
TGTGAGAAATGTAGAGTGCATCAACATCTAAACCTTTCACCTCAGCATTA
CTCTCAGCATTCTTGAGCAAGTCAAGAATGAACTTTGCTGATTTGACAGG
CCATCGTCCCTGTCCATTTGGATGCCTATTCTTTGCCTGAGCAGTACGTC
CAACACCACCGCAGAATCGTGTGAAGGGAATGGCCTGTTTATGGGCCATA
ACATCCTCCAAATACCTCTTAGCCTTCGTCAAAGGCAATTTCCTGATGGC
ATGGGCAGTTTCTCTCGTGTTCTTAAAATGAACCCTGAGATCAGAGCCCC
TGGCTTTGCAGGACTTGGTAGGATTGTCAGGCTCTTTTGAGTACTTCACC
ATGGTGGCTGATTTTGGATGCTGCCTCTGTATCAGTGAAGTGGGTTTGCT
TTCCTTTTTTTAATAGCTAGACAAAGAGAATCTCTTGTATATATCAAGAG
ATCTTACAAGTTAAACTGAA
back to top