CF834600

Overview
NameCF834600
Unique NameCF834600
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length870
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF834600 vs. ExPASy Swiss-Prot
Match: RL22_METM6 (50S ribosomal protein L22P OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl22p PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 8.327e-12
Identity = 49/150 (32.67%), Postives = 73/150 (48.67%), Query Frame = -2
Query:  300 VKYSKEPDNPTKSCKARGSDLRVHFKNTRETAHAIRKLPLTKAKRYLEDVMAHKQAIPFTRFCGGVGRTAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELTL 749
            +KY  E D P  + +A G  LR+  K+  E    +  + L  A  YL  V+A +  +PF      +      K +     GR+P K++  IL +L NA+ NAE KGL+ + L I HI  N+    +R   RA GR +P      HI++ L
Sbjct:    4 LKYKVEAD-PKNTARAMGRTLRISRKHAIELCRELSGMKLDAAVAYLNRVIALETPVPFKVHNKDL---PHRKGKIGTHSGRFPQKASLEILQVLDNAKKNAEQKGLNTEKLRIKHISSNRGFTIKRYMPRAFGRASPKNQETIHIQVIL 149          
BLAST of CF834600 vs. ExPASy Swiss-Prot
Match: RL22_METM5 (50S ribosomal protein L22P OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl22p PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 8.327e-12
Identity = 49/150 (32.67%), Postives = 73/150 (48.67%), Query Frame = -2
Query:  300 VKYSKEPDNPTKSCKARGSDLRVHFKNTRETAHAIRKLPLTKAKRYLEDVMAHKQAIPFTRFCGGVGRTAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELTL 749
            +KY  E D P  + +A G  LR+  K+  E    +  + L  A  YL  V+A +  +PF      +      K +     GR+P K++  IL +L NA+ NAE KGL+ + L I HI  N+    +R   RA GR +P      HI++ L
Sbjct:    4 LKYKVEAD-PKNTARAMGRTLRISRKHAIELCRELSGMKLDAAVAYLNRVIALETPVPFKVHNKDL---PHRKGKIGTHSGRFPQKASLEILQVLDNAKKNAEQKGLNTEKLRIKHISSNRGFTIKRYMPRAFGRASPKNQETIHIQVIL 149          
BLAST of CF834600 vs. ExPASy Swiss-Prot
Match: RL22_HALSA (50S ribosomal protein L22P OS=Halobacterium salinarium GN=rpl22p PE=1 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 8.327e-12
Identity = 42/151 (27.81%), Postives = 77/151 (50.99%), Query Frame = -2
Query:  297 VKYSKEPDNPTKSCKARGSDLRVHFKNTRETAHAIRKLPLTKAKRYLEDVMAHKQAIPFTRFCGGVGRTAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELTLS 749
            + YS + D+   S KA   +  +  K+++  A  I    +  AK YL+ V+  ++++PF +   GVG             GR+P K++K  L LL N  +NA+ +G D D + I H+  ++  + + R  RA GR   + ++ C +E+ ++
Sbjct:    3 ISYSVDVDSEA-SAKAMLRERSISLKHSKAIAREISGETVADAKEYLQAVIDEERSVPFKQHNSGVGHRNDIDGWDA---GRYPEKASKDFLKLLSNVSNNADQQGFDADEMVIEHVAPHKVGESQGRKPRAMGRATTWNATLCDVEIVVT 149          
BLAST of CF834600 vs. ExPASy Swiss-Prot
Match: RL22_METS5 (50S ribosomal protein L22P OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rpl22p PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.420e-11
Identity = 40/126 (31.75%), Postives = 66/126 (52.38%), Query Frame = -2
Query:  306 VHFKNTRETAHAIRKLPLTKAKRYLEDVMAHKQAIPFTRFCGGVGRTAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIEL 683
            V  K+      AIR + + +A+ +L+ VM  K+A+P+ R+  G    +    +     GR+P K+ K++   L+NA +NA+ KGLD D L + HI  ++    +R   RA GR     +   HIE+
Sbjct:   26 VSIKDLYNVCKAIRGMNVKEAQAFLQRVMEEKEALPYWRYDHGASHKSNISRKWKVKSGRYPKKAIKYVNKALENALANAQGKGLDEDKLKVVHIAAHKGIIIKRFMPRAFGRATKKYNRTSHIEV 151          
BLAST of CF834600 vs. ExPASy Swiss-Prot
Match: RL22_PYRAE (50S ribosomal protein L22P OS=Pyrobaculum aerophilum GN=rpl22p PE=3 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 3.164e-11
Identity = 44/139 (31.65%), Postives = 69/139 (49.64%), Query Frame = -2
Query:  306 PTKSCKARGSDLRVHFKNTRETAHAIRKLPLTKAKRYLEDVMAHKQAIPFTRFCGGVGRTAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIEL 722
            P +  +A   + R+ +K + E A  I+ + L +AK +LEDV+  K+ +P   F       A      P    +WPVK A+  L +L+N E+NA  +GLDVD + I H   ++  K      RA GR   +     ++EL
Sbjct:   28 PEQIARAYAPEQRMSWKKSVEVARFIKGMTLKQAKTWLEDVVKLKRPVPIKTFKKKQAHHATPWEGWP--VAKWPVKVARRFLQVLENLENNARFRGLDVDRVVIVHAAAHKGFKIPNIMPRAFGRATRFDEQTVNVEL 164          
BLAST of CF834600 vs. ExPASy Swiss-Prot
Match: RL22_THENV (50S ribosomal protein L22P OS=Thermoproteus neutrophilus (strain DSM 2338 / JCM 9278 / V24Sta) GN=rpl22p PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 4.133e-11
Identity = 43/134 (32.09%), Postives = 68/134 (50.75%), Query Frame = -2
Query:  306 KARGSDLRVHFKNTRETAHAIRKLPLTKAKRYLEDVMAHKQAIPFTRFCGGVGRTAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIEL 707
            KA   + ++ +K + E A  I  + L +AK +LEDV+  K+ IP   F       A   +  P    +WPVK A+  LDLL+N E+NA  +GLDV+ + I H   ++  +      RA GR   +     ++E+
Sbjct:   33 KAYAPEQKMSWKKSVEVARFIEGMTLRQAKSWLEDVVKMKRPIPIRTFKKKQAHHATPWSGWP--VAKWPVKVARRFLDLLENLENNARFRGLDVERVVIVHAAAHKGYRIHNIMPRAFGRATRFDEQTVNVEV 164          
BLAST of CF834600 vs. ExPASy Swiss-Prot
Match: RL22_PYRIL (50S ribosomal protein L22P OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189) GN=rpl22p PE=3 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 4.133e-11
Identity = 43/134 (32.09%), Postives = 70/134 (52.24%), Query Frame = -2
Query:  306 KARGSDLRVHFKNTRETAHAIRKLPLTKAKRYLEDVMAHKQAIPFTRFCGGVGRTAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIEL 707
            +A   + ++ +K + E A  I+ + L +AK +LEDV+  K+ IP   F       A   +  P    +WPVK AK  LDLL+N E+NA+ +GLDV+ + I H   ++  +      RA GR   +     ++E+
Sbjct:   33 RAYAPEQKMSWKKSVEVARFIKGMTLRQAKSWLEDVVKMKRPIPIKTFKKKQAHHAVPWSGWP--VAKWPVKVAKRFLDLLENLENNAKFRGLDVERVVIVHAAAHKGYRIPNIMPRAFGRATRFDEQTVNVEV 164          
BLAST of CF834600 vs. ExPASy Swiss-Prot
Match: RL22_PYRAR (50S ribosomal protein L22P OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rpl22p PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 9.206e-11
Identity = 50/171 (29.24%), Postives = 78/171 (45.61%), Query Frame = -2
Query:  306 SY*KKESKPTSLIQRQHPKSATMVKYSKEPDNPTKSCKARGSDLRVHFKNTRETAHAIRKLPLTKAKRYLEDVMAHKQAIPFTRFCGGVGRTAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIEL 818
            SY   + K   L+ RQ+    T          P +  KA   + R+ +K + E A  I  + L +AK +LEDV+  K+ IP   +       A      P    +WPVK A+  L LL+N E+NA+ KGLD D + I +   ++  +      RA GR   +     ++E+
Sbjct:    6 SYSLSDEKVAELVFRQYGVKIT----------PEQIAKAYAPEQRMSWKKSIEVARFITGMTLKQAKAWLEDVVKLKRPIPIKTYKKKQAHHAAPWRGWP--VAKWPVKVARRYLQLLENLENNAKFKGLDADRVVIVYAAAHKGYRIPNIMPRAFGRATRFDEQTVNVEI 164          
BLAST of CF834600 vs. ExPASy Swiss-Prot
Match: RL22_METHJ (50S ribosomal protein L22P OS=Methanospirillum hungatei (strain JF-1 / DSM 864) GN=rpl22p PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 9.206e-11
Identity = 47/136 (34.56%), Postives = 67/136 (49.26%), Query Frame = -2
Query:  300 KARGSDLRVHFKNTRETAHAIRKLPLTKAKRYLEDVMAHKQAIPFTRFCGGVGRTAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELTL 707
            + R ++  +  K+  E A  IR + L  A  YLE V+A ++ IPF RF   V      K       GR+P K+++  L LL N   NAE  GL+ D L I H+  N+  ++R    RA GR  P      +IEL +
Sbjct:   17 RGRVNEAPISPKHAIEIAGFIRGMKLDDAAAYLEGVVALQKPIPFKRFNRNV---PHRKGLVGWDAGRYPQKASRVYLRLLNNVRKNAEYNGLEGDQLRIVHVSANRGIRRRSFMPRAMGRATPKDRQTVNIELVV 149          
The following BLAST results are available for this feature:
BLAST of CF834600 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 89
Match NameE-valueIdentityDescription
RL22_METM68.327e-1232.6750S ribosomal protein L22P OS=Methanococcus maripa... [more]
RL22_METM58.327e-1232.6750S ribosomal protein L22P OS=Methanococcus maripa... [more]
RL22_HALSA8.327e-1227.8150S ribosomal protein L22P OS=Halobacterium salina... [more]
RL22_METS51.420e-1131.7550S ribosomal protein L22P OS=Metallosphaera sedul... [more]
RL22_PYRAE3.164e-1131.6550S ribosomal protein L22P OS=Pyrobaculum aerophil... [more]
RL22_THENV4.133e-1132.0950S ribosomal protein L22P OS=Thermoproteus neutro... [more]
RL22_PYRIL4.133e-1132.0950S ribosomal protein L22P OS=Pyrobaculum islandic... [more]
RL22_PYRAR9.206e-1129.2450S ribosomal protein L22P OS=Pyrobaculum arsenati... [more]
RL22_METHJ9.206e-1134.5650S ribosomal protein L22P OS=Methanospirillum hun... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_05M23_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa05M23, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834600 ID=CF834600; Name=CF834600; organism=Citrus sinensis; type=EST; length=870bp
TTTTTTTTTTTTTAAGCTTGAAAGTCTTTAATTTTCATAAAGCCCCTACA
GTATGACTGAGGATTCTAACAAAACAGTAAACTGGACTTAATATGAAATA
AACAAAATATGATGTCTGATTTGACTAAATAACATCTCAGTCACTATTAA
AGGTAAAAAAACTCACTTCATCAAGAACACAAAATAGAAAATCAATGCAC
TCTCCAATTGCTATGCTAAACCTCAGACAATTACTTCTTTGATTTGCTAG
TTGCCAACTGGGTCTCAGGCTCTTTCTTTACTGGCTCTTCCTTTTCAGAT
AAGGTCAACTCAATATGGCAGGGAGAGGACATGTAAGGATTAATTCTTCC
ATGAGCACGGTATGTGCGGCGCCTTTGCTTTTGTGCCTGGTTGACTTGGA
TGTGAGAAATGTAGAGTGCATCAACATCTAAACCTTTCACCTCAGCATTA
CTCTCAGCATTCTTGAGCAAGTCAAGAATGAACTTTGCTGATTTGACAGG
CCATCGTCCCTGTCCATTTGGATGCCTATTCTTTGCCTGAGCAGTACGTC
CAACACCACCGCAGAATCGTGTGAAGGGAATGGCCTGTTTATGGGCCATA
ACATCCTCCAAATACCTCTTAGCCTTCGTCAAAGGCAATTTCCTGATGGC
ATGGGCAGTTTCTCTCGTGTTCTTAAAATGAACCCTGAGATCAGAGCCCC
TGGCTTTGCAGGACTTGGTAGGATTGTCAGGCTCTTTTGAGTACTTCACC
ATGGTGGCTGATTTTGGATGCTGCCTCTGTATCAGTGAAGTGGGTTTGCT
TTCCTTTTTTTAATAGCTAGACAAAGAGAATCTCTTGTATATATCAAGAG
ATCTTACAAGTTAAACTGAA
back to top