CF834862

Overview
NameCF834862
Unique NameCF834862
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length278
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_CHLRE (Ubiquitin OS=Chlamydomonas reinhardtii GN=UBI1 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.347e-11
Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = -1
Query:  183 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 278
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   45 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_BRARA (Ubiquitin OS=Brassica rapa PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.347e-11
Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = -1
Query:  183 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 278
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   45 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_AVESA (Ubiquitin OS=Avena sativa PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.347e-11
Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = -1
Query:  183 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 278
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   45 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_AVEFA (Ubiquitin OS=Avena fatua PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.347e-11
Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = -1
Query:  183 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 278
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   45 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_ASPOF (Ubiquitin OS=Asparagus officinalis PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.347e-11
Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = -1
Query:  183 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 278
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   45 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_ARATH (Ubiquitin OS=Arabidopsis thaliana GN=UBQ1 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.347e-11
Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = -1
Query:  183 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 278
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   45 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_ACECL (Ubiquitin OS=Acetabularia cliftonii PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.347e-11
Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = -1
Query:  183 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 278
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   45 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_ACACA (Ubiquitin OS=Acanthamoeba castellanii PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.347e-11
Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = -1
Query:  183 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 278
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   45 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_YEAST (Ubiquitin OS=Saccharomyces cerevisiae GN=UBI1 PE=1 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.455e-11
Identity = 31/32 (96.88%), Postives = 32/32 (100.00%), Query Frame = -1
Query:  183 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 278
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct:   45 FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG 76          
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_XENLA (Ubiquitin OS=Xenopus laevis PE=1 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.455e-11
Identity = 31/32 (96.88%), Postives = 32/32 (100.00%), Query Frame = -1
Query:  183 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 278
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct:   45 FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG 76          
The following BLAST results are available for this feature:
BLAST of CF834862 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 69
Match NameE-valueIdentityDescription
UBIQ_CHLRE3.347e-11100.00Ubiquitin OS=Chlamydomonas reinhardtii GN=UBI1 PE=... [more]
UBIQ_BRARA3.347e-11100.00Ubiquitin OS=Brassica rapa PE=3 SV=1[more]
UBIQ_AVESA3.347e-11100.00Ubiquitin OS=Avena sativa PE=1 SV=1[more]
UBIQ_AVEFA3.347e-11100.00Ubiquitin OS=Avena fatua PE=3 SV=1[more]
UBIQ_ASPOF3.347e-11100.00Ubiquitin OS=Asparagus officinalis PE=3 SV=1[more]
UBIQ_ARATH3.347e-11100.00Ubiquitin OS=Arabidopsis thaliana GN=UBQ1 PE=1 SV=... [more]
UBIQ_ACECL3.347e-11100.00Ubiquitin OS=Acetabularia cliftonii PE=3 SV=1[more]
UBIQ_ACACA3.347e-11100.00Ubiquitin OS=Acanthamoeba castellanii PE=3 SV=1[more]
UBIQ_YEAST7.455e-1196.88Ubiquitin OS=Saccharomyces cerevisiae GN=UBI1 PE=1... [more]
UBIQ_XENLA7.455e-1196.88Ubiquitin OS=Xenopus laevis PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06E02_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06E02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834862 ID=CF834862; Name=CF834862; organism=Citrus sinensis; type=EST; length=278bp
TAGATATTATAATGGGACGTTAGTGGGACCATATCAATATCTTAGAAACA
GAGTTCAACTACCACAAACCAAAATAAACTTCAAATAGTTATTTAAGCTA
TTTCACCAATAGCCAGCAAACATTAACCAAGACAAACCGAAGCAAATAAG
ACACACACACACCCAGATGACCAAACTCAGAAACCTCCACGGAGTCGGAG
CACAAGATGCAGAGTGGACTCCTTCTGGATGTTGTAATCAGCAAGAGTCC
TTCCATCCTCAAGTTGTTTTCCAGCAAA
back to top