CF835317

Overview
NameCF835317
Unique NameCF835317
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length849
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9291 contig Csv1_Contig9291:524..1372. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS8_IPOBA (Chalcone synthase DIV OS=Ipomoea batatas GN=CHS-DIV PE=2 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 8.341e-94
Identity = 173/231 (74.89%), Postives = 189/231 (81.82%), Query Frame = -2
Query:  156 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVP 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVL+VCSEIT VTFRGP++THLDSLVGQALF           DP T  E+PL+QLVS +QT+ P+S GAIDGHLREVGLTFHLLKDVP ++S NIEK L EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK S+     TTGEGL+WGVLFGFGPGLT+ETVVLHSVP
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADP-TPAEKPLFQLVSAAQTLAPNSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVP 387          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS6_IPOBA (Chalcone synthase DII OS=Ipomoea batatas GN=CHS-DII PE=2 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 1.089e-93
Identity = 174/233 (74.68%), Postives = 190/233 (81.55%), Query Frame = -2
Query:  150 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIK 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVL+VCSEIT VTFRGP++THLDSLVGQALF           DP T  E+PL+QLVS +QT+ P+S GAIDGHLREVGLTFHLLKDVP ++S NIEK L EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK S+     TTGEGL+WGVLFGFGPGLT+ETVVLHSV IK
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADP-TPAEKPLFQLVSAAQTLAPNSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVLIK 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS8_MEDSA (Chalcone synthase 8 OS=Medicago sativa GN=CHS8 PE=2 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 1.423e-93
Identity = 172/232 (74.14%), Postives = 193/232 (83.19%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+P++++V T+QTI PDS+G IDGHLRE GLTFHLLKDVPG++SKNI K+L EAF P+GISD+NSIFWIAHPGGPAILDQV           KATR+VLSEYGNMSSACVL ILDEMRKKSA++   TTGEGL++GVLFGFGPGLT+ETVVL SV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGGIDGHLREAGLTFHLLKDVPGIVSKNINKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMKATREVLSEYGNMSSACVLVILDEMRKKSAQDGLKTTGEGLEFGVLFGFGPGLTIETVVLRSVAI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: THS1_VITVI (Stilbene synthase 1 OS=Vitis vinifera GN=VINST1 PE=1 SV=2)

HSP 1 Score: 334.339 bits (856), Expect = 5.060e-91
Identity = 169/231 (73.16%), Postives = 188/231 (81.39%), Query Frame = -2
Query:  156 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVP 848
            M+Y QGC+AGGTVLR AKDLAENN GARVLVVCSEIT VTFRGP++  LDSLVGQALF           DPD S+ERPL+QLVS +QT +P+S GAI G+LREVGLTFHL  +VP LIS+NIEK L++AF P+GISDWNS+FWIAHPGGPAILD V           +ATR VLSEYGNMSSACVLFILDEMRKKS +  KATTGEGLDWGVLFGFGPGLT+ETVVLHSVP
Sbjct:  158 MLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSSAVIVGSDPDVSIERPLFQLVSAAQTFIPNSAGAIAGNLREVGLTFHLWPNVPTLISENIEKCLTQAFDPLGISDWNSLFWIAHPGGPAILDAVEAKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRKKSLKGEKATTGEGLDWGVLFGFGPGLTIETVVLHSVP 388          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: THS3_VITVI (Stilbene synthase 3 (Fragment) OS=Vitis vinifera PE=2 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 8.631e-91
Identity = 167/232 (71.98%), Postives = 189/232 (81.47%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            M+Y QGC+AGGTVLR AKDLAENN GARVLVVCSEIT VTFRGP++  LDSLVGQALF           DPD S+ERPL+QLVS +QT +P+S GAI G+LREVGLTFHL  +VP LIS+N+EK L++AF P+GISDWNS+FWIAHPGGPAILD V           +ATR VLSEYGNMSSACVLFILDEMRKKS +  KATTGEGLDWGVLFGFGPGLT+ETVVLHS+P+
Sbjct:  155 MLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPDVSIERPLFQLVSAAQTFIPNSAGAIAGNLREVGLTFHLWPNVPTLISENVEKCLTQAFDPLGISDWNSLFWIAHPGGPAILDAVEAKLNLDKKKLEATRHVLSEYGNMSSACVLFILDEMRKKSHKGEKATTGEGLDWGVLFGFGPGLTIETVVLHSIPM 386          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: THS2_VITVI (Stilbene synthase 2 OS=Vitis vinifera GN=GSVIVT00004047001 PE=2 SV=2)

HSP 1 Score: 332.798 bits (852), Expect = 1.472e-90
Identity = 167/232 (71.98%), Postives = 189/232 (81.47%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            M+Y QGC+AGGTVLR AKDLAENN GARVLVVCSEIT VTFRGP++  LDSLVGQALF           DPD S+ERPL+QLVS +QT +P+S GAI G+LREVGLTFHL  +VP LIS+NIEK L++AF P+GISDWNS+FWIAHPGGPAILD V           +ATR VLSEYGNMSSACVLFILDEMRKKS +  +ATTGEGLDWGVLFGFGPGLT+ETVVLHS+P+
Sbjct:  158 MLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPDISIERPLFQLVSAAQTFIPNSAGAIAGNLREVGLTFHLWPNVPTLISENIEKCLTQAFDPLGISDWNSLFWIAHPGGPAILDAVEAKLNLDKKKLEATRHVLSEYGNMSSACVLFILDEMRKKSLKGERATTGEGLDWGVLFGFGPGLTIETVVLHSIPM 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_VIGUN (Chalcone synthase OS=Vigna unguiculata GN=CHS PE=2 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 1.923e-90
Identity = 171/232 (73.71%), Postives = 190/232 (81.90%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DP   +E+PL++LV T+QTI PDS+GAIDGHLREVGLTFHLLKDVPG++SKNI K+LSEAF P+ ISD+NSIFWIAHPGGPAILDQV           KATR VLS+YGNMSSACV F LDE+ +KS E    TTG+ L+WGVLFGFGPGL++ETVVLHSV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPQIEKPLFELVWTAQTIAPDSEGAIDGHLREVGLTFHLLKDVPGIVSKNIGKALSEAFDPLNISDYNSIFWIAHPGGPAILDQVAQKLGLKPEKMKATRDVLSDYGNMSSACVTFHLDEI-EKSVENGLKTTGKDLEWGVLFGFGPGLSLETVVLHSVAI 388          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: THS7_VITVI (Stilbene synthase 6 OS=Vitis vinifera GN=STS PE=2 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 2.511e-90
Identity = 167/231 (72.29%), Postives = 187/231 (80.95%), Query Frame = -2
Query:  156 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVP 848
            M+Y QGC+AGGTVLR AKDLAENN GARVLVVCSEIT VTFRGP++  LDSLVGQALF           DPD S+ERPL+QLVS +QT +P+S GAI G+LREVGLTFHL  +VP LIS+NIEK L++AF P+GISDWNS+FWIAHPGGPAILD V           +ATR VLSEYGNMSSACVLFILDEMRKKS +   ATTGEGLDWGVLFGFGPGLT+ETVVLHS+P
Sbjct:  158 MLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSSAVIVGSDPDVSIERPLFQLVSAAQTFIPNSAGAIAGNLREVGLTFHLWPNVPTLISENIEKCLTQAFDPLGISDWNSLFWIAHPGGPAILDAVEAKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRKKSLKGENATTGEGLDWGVLFGFGPGLTIETVVLHSIP 388          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: THS5_VITVI (Stilbene synthase 5 OS=Vitis vinifera GN=GSVIVT00007357001 PE=3 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 2.511e-90
Identity = 168/232 (72.41%), Postives = 189/232 (81.47%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            M+Y QGC+AGGTVLR AKDLAENN GARVLVVCSEIT VTFRGP++  LDSLVGQALF           DP+ S+ERPL+QLVS +QT +P+S GAI G+LREVGLTFHL  +VP LIS+NIEK LS+AF P+GIS+WNS+FWIAHPGGPAILD V           +ATR VLSEYGNMSSACVLFILDEMRKKS +  KATTGEGLDWGVLFGFGPGLT+ETVVLHSVP+
Sbjct:  158 MLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPNVSIERPLFQLVSAAQTFIPNSAGAIAGNLREVGLTFHLWPNVPTLISENIEKCLSQAFDPLGISNWNSLFWIAHPGGPAILDAVEAKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRKKSLKGEKATTGEGLDWGVLFGFGPGLTIETVVLHSVPM 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: ACS2_RUTGR (Acridone synthase 2 OS=Ruta graveolens GN=ACS2 PE=1 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 3.280e-90
Identity = 164/234 (70.09%), Postives = 188/234 (80.34%), Query Frame = -2
Query:  147 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIKA 848
            M+Y QGC+AGGTVLRLAKDLAENNKG+RVLVVCSE+TA TFRGP+   +DSLVGQALF           DPDTSVER LY +VS SQ +LPDSDGAI+GH+RE GLT HL KDVP L S NI+  L EAF P+GISDWNSIFWIAHPGGPAILDQ+           +A++ V+SEYGNMSS+CVLF+LDEMR KS ++ K+TTGEGLDWGVLFGFGPGLTVETVVL SVP++A
Sbjct:  158 MIYQQGCYAGGTVLRLAKDLAENNKGSRVLVVCSELTAPTFRGPSPDAVDSLVGQALFADGAAALVVGADPDTSVERALYYIVSASQMLLPDSDGAIEGHIREEGLTVHLKKDVPALFSANIDTPLVEAFRPLGISDWNSIFWIAHPGGPAILDQIEVKLGLKEDKLRASKHVMSEYGNMSSSCVLFVLDEMRNKSLQDGKSTTGEGLDWGVLFGFGPGLTVETVVLRSVPVEA 391          
The following BLAST results are available for this feature:
BLAST of CF835317 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 147
Match NameE-valueIdentityDescription
CHS8_IPOBA8.341e-9474.89Chalcone synthase DIV OS=Ipomoea batatas GN=CHS-DI... [more]
CHS6_IPOBA1.089e-9374.68Chalcone synthase DII OS=Ipomoea batatas GN=CHS-DI... [more]
CHS8_MEDSA1.423e-9374.14Chalcone synthase 8 OS=Medicago sativa GN=CHS8 PE=... [more]
THS1_VITVI5.060e-9173.16Stilbene synthase 1 OS=Vitis vinifera GN=VINST1 PE... [more]
THS3_VITVI8.631e-9171.98Stilbene synthase 3 (Fragment) OS=Vitis vinifera P... [more]
THS2_VITVI1.472e-9071.98Stilbene synthase 2 OS=Vitis vinifera GN=GSVIVT000... [more]
CHSY_VIGUN1.923e-9073.71Chalcone synthase OS=Vigna unguiculata GN=CHS PE=2... [more]
THS7_VITVI2.511e-9072.29Stilbene synthase 6 OS=Vitis vinifera GN=STS PE=2 ... [more]
THS5_VITVI2.511e-9072.41Stilbene synthase 5 OS=Vitis vinifera GN=GSVIVT000... [more]
ACS2_RUTGR3.280e-9070.09Acridone synthase 2 OS=Ruta graveolens GN=ACS2 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A15_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A15, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835317 ID=CF835317|Name=CF835317|organism=Citrus sinensis|type=EST|length=849bp
TTTTGACGTCATCAGTGAAAAGGTACGATGCCTTAAATTCAATTGACAAA
ACTAAACCTTCACACGATCAACCAATAATTCAAGAGTGAAAGCATACAAC
ATAAAGTTACTGAACTACTAAACATACTGATGGAGTTCTCACTTCAAGCT
TTGATGGGGACACTGTGCAGCACAACGGTCTCGACGGTGAGCCCCGGCCC
GAACCCGAACAGCACACCCCAATCTAGCCCTTCGCCGGTGGTGGCTTTCG
CTTCCTCAGCAGACTTCTTTCTCATCTCGTCAAGGATGAACAGGACACAA
GCGCTTGACATGTTACCGTACTCACTCAACACTTGACGTGTGGCCTTCAG
CTTCTCCTCTTTGAGGCCGAGTTTAGACTCCACTTGGTCCAGAATTGCGG
GCCCACCGGGGTGAGCGATCCAGAATATCGAGTTCCAGTCGCTGATGCCA
ACCGGGGCGAACGCTTCCGACAGGCTTTTCTCTATATTCTTTGAGATCAA
GCCGGGGACGTCTTTAAGCAAATGGAAAGTGAGACCGACTTCGCGCAAGT
GTCCGTCAATTGCACCGTCAGAGTCAGGGAGGATCGTCTGCGAAGTCGAC
ACAAGCTGATACAACGGACGCTCGACCGACGTGTCAGGATCGGCACCCAC
GATCACAGCAGCAGCACCATCACCGAACAAAGCCTGGCCCACAAGAGAAT
CAAGATGAGTATCGGCAGGGCCGCGGAAAGTGACCGCCGTGATCTCCGAA
CAGACAACAAGAACGCGAGCGCCCTTGTTGTTCTCAGCCAAGTCTTTAGC
GAGGCGAAGAACAGTGCCGCCGGCGAAACATCCTTGNTGGTACATCATG
back to top