CF835317

Overview
NameCF835317
Unique NameCF835317
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length849
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9291 contig Csv1_Contig9291:524..1372. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS2_SOLTU (Chalcone synthase 2 OS=Solanum tuberosum GN=CHS2 PE=2 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 1.017e-99
Identity = 183/230 (79.57%), Postives = 197/230 (85.65%), Query Frame = -2
Query:  159 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 848
            MMY QGCFAGGTV+RLAKDLAENNKGARVLVVCSEITAVTF GP+DTHLDS+VGQALF           DP   VERPL++LVS +QT+LPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GISDWNSIFWIAHPGGPAILDQV           +ATRQVLS+YGNMSSACVLFILDEMRK S++E  +TTGEGLDWGVLFGFGPGLTVETVVLHSV
Sbjct:  158 MMYQQGCFAGGTVIRLAKDLAENNKGARVLVVCSEITAVTFSGPSDTHLDSMVGQALFGDGAAAMIIGSDPLPEVERPLFELVSAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGISDWNSIFWIAHPGGPAILDQVELKLGLKPEKLQATRQVLSDYGNMSSACVLFILDEMRKASSKEGLSTTGEGLDWGVLFGFGPGLTVETVVLHSV 387          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSA_PETHY (Chalcone synthase A OS=Petunia hybrida GN=CHSA PE=2 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 1.735e-99
Identity = 185/230 (80.43%), Postives = 194/230 (84.35%), Query Frame = -2
Query:  159 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDSLVGQALF           DP   VERPL++LVS +QT+LPDS GAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GISDWNS+FWIAHPGGPAILDQV           KATR VLS+YGNMSSACVLFILDEMRK SA+E   TTGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELVSAAQTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGGPAILDQVEIKLGLKPEKLKATRNVLSDYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEWGVLFGFGPGLTVETVVLHSV 387          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS2_CAMSI (Chalcone synthase 2 OS=Camellia sinensis GN=CHS2 PE=2 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 2.266e-99
Identity = 183/230 (79.57%), Postives = 195/230 (84.78%), Query Frame = -2
Query:  159 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+D HLDSLVGQALF           DP   VE+PL++LVS +QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSL+EAF P+ I+DWNS+FWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK SA++   TTGEGLDWGVLFGFGPGLTVETVVLHSV
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLNITDWNSLFWIAHPGGPAILDQVELKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKSSAKKGLKTTGEGLDWGVLFGFGPGLTVETVVLHSV 387          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_HYDMC (Chalcone synthase OS=Hydrangea macrophylla GN=CHS PE=2 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 2.960e-99
Identity = 183/230 (79.57%), Postives = 194/230 (84.35%), Query Frame = -2
Query:  159 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DP   VE+PL+++VS +QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+ ISDWNSIFWIAHPGGPAILDQV           +ATR VLS+YGNMSSACVLFI+DEMRK SAEE   TTGEGL+WGVLFGFGPGLTVETVVLH V
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPMPEVEKPLFEIVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFRPLDISDWNSIFWIAHPGGPAILDQVEKKLALKPEKLRATRNVLSDYGNMSSACVLFIMDEMRKNSAEEGLMTTGEGLEWGVLFGFGPGLTVETVVLHGV 387          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSE_IPOPU (Chalcone synthase E OS=Ipomoea purpurea GN=CHSE PE=2 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 5.048e-99
Identity = 182/230 (79.13%), Postives = 195/230 (84.78%), Query Frame = -2
Query:  159 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 848
            MMY QGCFAGGTV+RLAKDLAENNKGARVLVVCSEITAVTFRGP+D HLDSLVGQALF           DPD  +ERPL+QLVS +QTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL+EAF P+GI DWNS+FWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK S++E   TTGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct:  158 MMYQQGCFAGGTVIRLAKDLAENNKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIRDWNSLFWIAHPGGPAILDQVEEKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTGEGLEWGVLFGFGPGLTVETVVLHSV 387          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSE_IPONI (Chalcone synthase E OS=Ipomoea nil GN=CHSE PE=2 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 5.048e-99
Identity = 182/230 (79.13%), Postives = 195/230 (84.78%), Query Frame = -2
Query:  159 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 848
            MMY QGCFAGGTV+RLAKDLAENNKGARVLVVCSEITAVTFRGP+D HLDSLVGQALF           DPD  +ERPL+QLVS +QTILPDS GAIDGHLREVGLTFHLLKDVPGLISK+IEKSL+EAF P+GI DWNS+FWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK S++E   TTGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct:  158 MMYQQGCFAGGTVIRLAKDLAENNKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWIAHPGGPAILDQVEEKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTGEGLEWGVLFGFGPGLTVETVVLHSV 387          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSB_PEA (Chalcone synthase 1B OS=Pisum sativum GN=CHS-1B PE=3 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 1.469e-98
Identity = 183/230 (79.57%), Postives = 196/230 (85.22%), Query Frame = -2
Query:  159 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DP   VE+PL++LV T+QTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIEK+L EAF P+GISD+NS+FWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMR+KS EE   TTGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPLPQVEKPLFELVWTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSLFWIAHPGGPAILDQVEAKLSLKQRKMQATRHVLSEYGNMSSACVLFILDEMRRKSKEEQLGTTGEGLEWGVLFGFGPGLTVETVVLHSV 387          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS3_CAMSI (Chalcone synthase 3 OS=Camellia sinensis GN=CHS3 PE=2 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 1.469e-98
Identity = 182/230 (79.13%), Postives = 194/230 (84.35%), Query Frame = -2
Query:  159 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVGQ+LF           DP   VE+PL++LVS +QTILP SDGAIDGHLREVGLTFHLLKDVP LIS N+EKSL EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRKKSAEE   TTGEGL+WGVLFGFGPGLTVETVVLHS+
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQSLFGDGAAAIIIGSDPIPEVEKPLFELVSAAQTILPSSDGAIDGHLREVGLTFHLLKDVPRLISMNVEKSLVEAFQPLGISDWNSLFWIAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKTTGEGLEWGVLFGFGPGLTVETVVLHSL 387          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS1_DAUCA (Chalcone synthase 1 OS=Daucus carota GN=CHS1 PE=2 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 1.469e-98
Identity = 181/231 (78.35%), Postives = 193/231 (83.55%), Query Frame = -2
Query:  156 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVP 848
            MMY QGCFAGGTVLRLAKDLAENNK ARVLVVCSEIT +TFRGP DTHLDSLVGQALF           DP   +E+PL+++VS +QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNI KSL EAF P+GISDWNSIFWIAHPGGPAILDQV           K+TRQVL +YGNMSSACVLFILDEMRK SA++   TTGEGLDWGVLFGFGPGLTVETVVLHSVP
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKNARVLVVCSEITVITFRGPNDTHLDSLVGQALFGDGAGAVIVGSDPVIGIEKPLFEIVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIRKSLVEAFKPLGISDWNSIFWIAHPGGPAILDQVETELSLKPEKLKSTRQVLRDYGNMSSACVLFILDEMRKASAKDGHRTTGEGLDWGVLFGFGPGLTVETVVLHSVP 388          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS1_SECCE (Chalcone synthase 1 OS=Secale cereale GN=CHS1 PE=3 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.918e-98
Identity = 181/234 (77.35%), Postives = 196/234 (83.76%), Query Frame = -2
Query:  147 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIKA 848
            MMY QGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP +   DSLVGQALF           DPD SVERPL+QLVS SQTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIE++L +AF P+GI DWNS+FWIAHPGGPAILD V           +ATR VLSEYGNMSSACVLFI+DEMRK+SAE+   TTGEG+DWGVLFGFGPGLTVETVVLHSVP+ A
Sbjct:  161 MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPHE--FDSLVGQALFGDGAAAVIVGADPDESVERPLFQLVSASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERALEDAFKPLGIDDWNSVFWIAHPGGPAILDMVEAKVNLNKERMRATRHVLSEYGNMSSACVLFIMDEMRKRSAEDGHTTTGEGMDWGVLFGFGPGLTVETVVLHSVPVTA 392          
The following BLAST results are available for this feature:
BLAST of CF835317 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 147
Match NameE-valueIdentityDescription
CHS2_SOLTU1.017e-9979.57Chalcone synthase 2 OS=Solanum tuberosum GN=CHS2 P... [more]
CHSA_PETHY1.735e-9980.43Chalcone synthase A OS=Petunia hybrida GN=CHSA PE=... [more]
CHS2_CAMSI2.266e-9979.57Chalcone synthase 2 OS=Camellia sinensis GN=CHS2 P... [more]
CHSY_HYDMC2.960e-9979.57Chalcone synthase OS=Hydrangea macrophylla GN=CHS ... [more]
CHSE_IPOPU5.048e-9979.13Chalcone synthase E OS=Ipomoea purpurea GN=CHSE PE... [more]
CHSE_IPONI5.048e-9979.13Chalcone synthase E OS=Ipomoea nil GN=CHSE PE=2 SV... [more]
CHSB_PEA1.469e-9879.57Chalcone synthase 1B OS=Pisum sativum GN=CHS-1B PE... [more]
CHS3_CAMSI1.469e-9879.13Chalcone synthase 3 OS=Camellia sinensis GN=CHS3 P... [more]
CHS1_DAUCA1.469e-9878.35Chalcone synthase 1 OS=Daucus carota GN=CHS1 PE=2 ... [more]
CHS1_SECCE1.918e-9877.35Chalcone synthase 1 OS=Secale cereale GN=CHS1 PE=3... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A15_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A15, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835317 ID=CF835317|Name=CF835317|organism=Citrus sinensis|type=EST|length=849bp
TTTTGACGTCATCAGTGAAAAGGTACGATGCCTTAAATTCAATTGACAAA
ACTAAACCTTCACACGATCAACCAATAATTCAAGAGTGAAAGCATACAAC
ATAAAGTTACTGAACTACTAAACATACTGATGGAGTTCTCACTTCAAGCT
TTGATGGGGACACTGTGCAGCACAACGGTCTCGACGGTGAGCCCCGGCCC
GAACCCGAACAGCACACCCCAATCTAGCCCTTCGCCGGTGGTGGCTTTCG
CTTCCTCAGCAGACTTCTTTCTCATCTCGTCAAGGATGAACAGGACACAA
GCGCTTGACATGTTACCGTACTCACTCAACACTTGACGTGTGGCCTTCAG
CTTCTCCTCTTTGAGGCCGAGTTTAGACTCCACTTGGTCCAGAATTGCGG
GCCCACCGGGGTGAGCGATCCAGAATATCGAGTTCCAGTCGCTGATGCCA
ACCGGGGCGAACGCTTCCGACAGGCTTTTCTCTATATTCTTTGAGATCAA
GCCGGGGACGTCTTTAAGCAAATGGAAAGTGAGACCGACTTCGCGCAAGT
GTCCGTCAATTGCACCGTCAGAGTCAGGGAGGATCGTCTGCGAAGTCGAC
ACAAGCTGATACAACGGACGCTCGACCGACGTGTCAGGATCGGCACCCAC
GATCACAGCAGCAGCACCATCACCGAACAAAGCCTGGCCCACAAGAGAAT
CAAGATGAGTATCGGCAGGGCCGCGGAAAGTGACCGCCGTGATCTCCGAA
CAGACAACAAGAACGCGAGCGCCCTTGTTGTTCTCAGCCAAGTCTTTAGC
GAGGCGAAGAACAGTGCCGCCGGCGAAACATCCTTGNTGGTACATCATG
back to top