CF835317

Overview
NameCF835317
Unique NameCF835317
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length849
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9291 contig Csv1_Contig9291:524..1372. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSB_SOLTU (Chalcone synthase 1B OS=Solanum tuberosum GN=CHS1B PE=2 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 3.272e-98
Identity = 180/230 (78.26%), Postives = 195/230 (84.78%), Query Frame = -2
Query:  159 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+++HLDSLVGQALF           DP   VERPL++LVS +QT++PDS+GAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATR+VLS YGNMSSACVLFILDEMRK S +E   TTGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIMGSDPIIGVERPLFELVSAAQTLVPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLLEAFQPLGISDWNSLFWIAHPGGPAILDQVELKLGLKQEKLRATREVLSNYGNMSSACVLFILDEMRKASTKEGLGTTGEGLEWGVLFGFGPGLTVETVVLHSV 387          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS1_SOLLC (Chalcone synthase 1 OS=Solanum lycopersicum GN=CHS1 PE=2 SV=2)

HSP 1 Score: 358.221 bits (918), Expect = 3.272e-98
Identity = 180/230 (78.26%), Postives = 195/230 (84.78%), Query Frame = -2
Query:  159 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+++HLDSLVGQALF           DP   VERPL++LVS +QT++PDS+GAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATR+VLS YGNMSSACVLFILDEMRK S +E   TTGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIIGSDPIIGVERPLFELVSAAQTLVPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLLEAFQPLGISDWNSLFWIAHPGGPAILDQVELKLGLKPEKLRATREVLSNYGNMSSACVLFILDEMRKASTKEGLGTTGEGLEWGVLFGFGPGLTVETVVLHSV 387          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS3_GERHY (Chalcone synthase 3 OS=Gerbera hybrida GN=CHS3 PE=2 SV=1)

HSP 1 Score: 357.836 bits (917), Expect = 4.274e-98
Identity = 178/231 (77.06%), Postives = 197/231 (85.28%), Query Frame = -2
Query:  156 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVP 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP + HLDSLVGQALF           DPD SVERPL+++VS +QTILPDS+GAIDGHL+EVGLTFHLLKDVP LI+KNIEK+L +AF+P+ I+DWNSIFWIAHPGGPAILDQV           +A+R VLSEYGNMSSACVLFILDEMRKKS ++ K TTGEGL+WGVLFGFGPGLTVETVVLHS+P
Sbjct:  164 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPNEGHLDSLVGQALFGDGAAAVIIGSDPDLSVERPLFEMVSAAQTILPDSEGAIDGHLKEVGLTFHLLKDVPALIAKNIEKALIQAFSPLNINDWNSIFWIAHPGGPAILDQVEFKLGLREEKLRASRHVLSEYGNMSSACVLFILDEMRKKSIKDGKTTTGEGLEWGVLFGFGPGLTVETVVLHSLP 394          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_CATRO (Chalcone synthase OS=Catharanthus roseus GN=CHS PE=2 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 5.582e-98
Identity = 180/232 (77.59%), Postives = 195/232 (84.05%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+++HLDSLVGQALF           DP   +ERPL++LVS +QT+LPDS GAIDGHLREVGLTFHLLKDVPGLISKNI K+L EAF P+GISDWNSIFWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK SA +  +TTGEGL+WGVLFGFGPGLTVETVVLHSV +
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIVGSDPIPEIERPLFELVSAAQTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIGKALDEAFQPLGISDWNSIFWIAHPGGPAILDQVEEKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASARDGLSTTGEGLEWGVLFGFGPGLTVETVVLHSVNV 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS9_DAUCA (Chalcone synthase 9 OS=Daucus carota GN=CHS9 PE=2 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 5.582e-98
Identity = 180/231 (77.92%), Postives = 192/231 (83.12%), Query Frame = -2
Query:  156 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVP 848
            MMY QGCFAGGTVLRLAKDLAENNK ARVLVVCSEIT +TFRGP DTHLDSLVGQALF           DP   +E+PL+++VS +QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNI KSL EAF P+GISDWNSIFWIAHPGGPAILDQV           K+TRQVL +YGNMSSACVLFILDEMR  SA++   TTGEGLDWGVLFGFGPGLTVETVVLHSVP
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKNARVLVVCSEITVITFRGPNDTHLDSLVGQALFGDGAGAVIVGSDPVIGIEKPLFEIVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIRKSLVEAFKPLGISDWNSIFWIAHPGGPAILDQVETELSLKPDKLKSTRQVLRDYGNMSSACVLFILDEMRNASAKDGHRTTGEGLDWGVLFGFGPGLTVETVVLHSVP 388          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS8_BROFI (Chalcone synthase 8 OS=Bromheadia finlaysoniana GN=CHS8 PE=2 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 7.290e-98
Identity = 176/232 (75.86%), Postives = 197/232 (84.91%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            M+Y QGCFAGGTVLRLAKDLAENN GARVLVVCSEITAVTFRGP+++HLDSLVGQALF           DPD++ ERPL+QLVS SQTILP+S+GAIDGHLRE+GLTFHLLKDVPGLISKNI+K L +AF P+G+ DWNSIFWIAHPGGPAILDQV            A+R VL+EYGNMSSACVLFILDEMR++SAE  +ATTGEGL+WGVLFGFGPGLTVET+VL SVPI
Sbjct:  159 MLYQQGCFAGGTVLRLAKDLAENNAGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIVGSDPDSATERPLFQLVSASQTILPESEGAIDGHLREIGLTFHLLKDVPGLISKNIQKCLLDAFKPLGVHDWNSIFWIAHPGGPAILDQVEIKLGLKAEKLAASRNVLAEYGNMSSACVLFILDEMRRRSAEAGQATTGEGLEWGVLFGFGPGLTVETIVLRSVPI 390          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS4_BROFI (Chalcone synthase 4 OS=Bromheadia finlaysoniana GN=CHS4 PE=2 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 7.290e-98
Identity = 176/232 (75.86%), Postives = 197/232 (84.91%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            M+Y QGCFAGGTVLRLAKDLAENN GARVLVVCSEITAVTFRGP+++HLDSLVGQALF           DPD++ ERPL+QLVS SQTILP+S+GAIDGHLRE+GLTFHLLKDVPGLISKNI+K L +AF P+G+ DWNSIFWIAHPGGPAILDQV            A+R VL+EYGNMSSACVLFILDEMR++SAE  +ATTGEGL+WGVLFGFGPGLTVET+VL SVPI
Sbjct:  159 MLYQQGCFAGGTVLRLAKDLAENNAGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIVGSDPDSATERPLFQLVSASQTILPESEGAIDGHLREIGLTFHLLKDVPGLISKNIQKCLLDAFKPLGVHDWNSIFWIAHPGGPAILDQVEIKLGLKAEKLAASRSVLAEYGNMSSACVLFILDEMRRRSAEAGQATTGEGLEWGVLFGFGPGLTVETIVLRSVPI 390          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS3_BROFI (Chalcone synthase 3 OS=Bromheadia finlaysoniana GN=CHS3 PE=2 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 7.290e-98
Identity = 176/232 (75.86%), Postives = 197/232 (84.91%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            M+Y QGCFAGGTVLRLAKDLAENN GARVLVVCSEITAVTFRGP+++HLDSLVGQALF           DPD++ ERPL+QLVS SQTILP+S+GAIDGHLRE+GLTFHLLKDVPGLISKNI+K L +AF P+G+ DWNSIFWIAHPGGPAILDQV            A+R VL+EYGNMSSACVLFILDEMR++SAE  +ATTGEGL+WGVLFGFGPGLTVET+VL SVPI
Sbjct:  159 MLYQQGCFAGGTVLRLAKDLAENNAGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIVGSDPDSATERPLFQLVSASQTILPESEGAIDGHLREIGLTFHLLKDVPGLISKNIQKCLLDAFKPLGVHDWNSIFWIAHPGGPAILDQVEIKLGLKAEKLAASRNVLAEYGNMSSACVLFILDEMRRRSAEAGQATTGEGLEWGVLFGFGPGLTVETIVLRSVPI 390          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSA_SOLTU (Chalcone synthase 1A OS=Solanum tuberosum GN=CHS1A PE=2 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 1.243e-97
Identity = 179/230 (77.83%), Postives = 193/230 (83.91%), Query Frame = -2
Query:  159 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 848
            MMY QGCF GGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+++HLDSLVGQALF           DP   VERPL++LVS +QT++PDS+GAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATR+VLS YGNMSSACVLFILDEMRK S  E   TTGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct:  158 MMYQQGCFVGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIMGSDPIIGVERPLFELVSAAQTLVPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLLEAFQPLGISDWNSLFWIAHPGGPAILDQVELKLGLKQEKLRATREVLSNYGNMSSACVLFILDEMRKASTNEGLGTTGEGLEWGVLFGFGPGLTVETVVLHSV 387          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS7_SOYBN (Chalcone synthase 7 OS=Glycine max GN=CHS7 PE=3 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 1.243e-97
Identity = 181/232 (78.02%), Postives = 195/232 (84.05%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DP   VE+PLY+LV T+QTI PDS+GAIDGHLREVGLTFHLLKDVPG++SKNI+K+L EAF P+ ISD+NSIFWIAHPGGPAILDQV           KATR VLSEYGNMSSACVLFILDEMR+KSAE    TTGEGL+WGVLFGFGPGLT+ETVVLHSV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPQVEKPLYELVWTAQTIAPDSEGAIDGHLREVGLTFHLLKDVPGIVSKNIDKALFEAFNPLNISDYNSIFWIAHPGGPAILDQVEQKLGLKPEKMKATRDVLSEYGNMSSACVLFILDEMRRKSAENGHKTTGEGLEWGVLFGFGPGLTIETVVLHSVAI 389          
The following BLAST results are available for this feature:
BLAST of CF835317 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 147
Match NameE-valueIdentityDescription
CHSB_SOLTU3.272e-9878.26Chalcone synthase 1B OS=Solanum tuberosum GN=CHS1B... [more]
CHS1_SOLLC3.272e-9878.26Chalcone synthase 1 OS=Solanum lycopersicum GN=CHS... [more]
CHS3_GERHY4.274e-9877.06Chalcone synthase 3 OS=Gerbera hybrida GN=CHS3 PE=... [more]
CHSY_CATRO5.582e-9877.59Chalcone synthase OS=Catharanthus roseus GN=CHS PE... [more]
CHS9_DAUCA5.582e-9877.92Chalcone synthase 9 OS=Daucus carota GN=CHS9 PE=2 ... [more]
CHS8_BROFI7.290e-9875.86Chalcone synthase 8 OS=Bromheadia finlaysoniana GN... [more]
CHS4_BROFI7.290e-9875.86Chalcone synthase 4 OS=Bromheadia finlaysoniana GN... [more]
CHS3_BROFI7.290e-9875.86Chalcone synthase 3 OS=Bromheadia finlaysoniana GN... [more]
CHSA_SOLTU1.243e-9777.83Chalcone synthase 1A OS=Solanum tuberosum GN=CHS1A... [more]
CHS7_SOYBN1.243e-9778.02Chalcone synthase 7 OS=Glycine max GN=CHS7 PE=3 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A15_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A15, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835317 ID=CF835317|Name=CF835317|organism=Citrus sinensis|type=EST|length=849bp
TTTTGACGTCATCAGTGAAAAGGTACGATGCCTTAAATTCAATTGACAAA
ACTAAACCTTCACACGATCAACCAATAATTCAAGAGTGAAAGCATACAAC
ATAAAGTTACTGAACTACTAAACATACTGATGGAGTTCTCACTTCAAGCT
TTGATGGGGACACTGTGCAGCACAACGGTCTCGACGGTGAGCCCCGGCCC
GAACCCGAACAGCACACCCCAATCTAGCCCTTCGCCGGTGGTGGCTTTCG
CTTCCTCAGCAGACTTCTTTCTCATCTCGTCAAGGATGAACAGGACACAA
GCGCTTGACATGTTACCGTACTCACTCAACACTTGACGTGTGGCCTTCAG
CTTCTCCTCTTTGAGGCCGAGTTTAGACTCCACTTGGTCCAGAATTGCGG
GCCCACCGGGGTGAGCGATCCAGAATATCGAGTTCCAGTCGCTGATGCCA
ACCGGGGCGAACGCTTCCGACAGGCTTTTCTCTATATTCTTTGAGATCAA
GCCGGGGACGTCTTTAAGCAAATGGAAAGTGAGACCGACTTCGCGCAAGT
GTCCGTCAATTGCACCGTCAGAGTCAGGGAGGATCGTCTGCGAAGTCGAC
ACAAGCTGATACAACGGACGCTCGACCGACGTGTCAGGATCGGCACCCAC
GATCACAGCAGCAGCACCATCACCGAACAAAGCCTGGCCCACAAGAGAAT
CAAGATGAGTATCGGCAGGGCCGCGGAAAGTGACCGCCGTGATCTCCGAA
CAGACAACAAGAACGCGAGCGCCCTTGTTGTTCTCAGCCAAGTCTTTAGC
GAGGCGAAGAACAGTGCCGCCGGCGAAACATCCTTGNTGGTACATCATG
back to top