CF835317

Overview
NameCF835317
Unique NameCF835317
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length849
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9291 contig Csv1_Contig9291:524..1372. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS5_SOYBN (Chalcone synthase 5 OS=Glycine max GN=CHS5 PE=3 SV=1)

HSP 1 Score: 355.14 bits (910), Expect = 2.770e-97
Identity = 184/232 (79.31%), Postives = 194/232 (83.62%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDSLVGQALF           DP   VE+PL+QLV T+QTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIEK+L EAF P+GISD+NSIFWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILD+MRKKS E    TTGEGLDWGVLFGFGPGLTVETVVL SV +
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDP-LPVEKPLFQLVWTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFWIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGTTGEGLDWGVLFGFGPGLTVETVVLRSVTV 388          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS1_SOYBN (Chalcone synthase 1 OS=Glycine max GN=CHS1 PE=3 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 3.618e-97
Identity = 184/232 (79.31%), Postives = 194/232 (83.62%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDSLVGQALF           DP   VE+PL+QLV T+QTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIEK+L EAF P+GISD+NSIFWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILD+MRKKS E    TTGEGLDWGVLFGFGPGLTVETVVL SV +
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDP-LPVEKPLFQLVWTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFWIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGTTGEGLDWGVLFGFGPGLTVETVVLRSVTL 388          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS6_MEDSA (Chalcone synthase 6-4 (Fragment) OS=Medicago sativa GN=CHS6-4 PE=2 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 1.053e-96
Identity = 175/232 (75.43%), Postives = 196/232 (84.48%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLKDVPG++SKNI+K+L EAF P+ ISD+NSIFWIAHPGGPAILDQV           KATR+VLSEYGNMSSACVLFILDEMRKKSA++   TTGEGLDWGVLFGFGPGLT+ETVVLHSV +
Sbjct:   54 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPIPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKDVPGIVSKNIDKALVEAFQPLNISDYNSIFWIAHPGGPAILDQVEQKLGLKPEKMKATREVLSEYGNMSSACVLFILDEMRKKSAQQGLKTTGEGLDWGVLFGFGPGLTIETVVLHSVAL 285          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS9_MEDSA (Chalcone synthase 9 OS=Medicago sativa GN=CHS9 PE=2 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 1.375e-96
Identity = 176/232 (75.86%), Postives = 195/232 (84.05%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLKDVPG++SKNI+K+L EAF P+ ISD+NSIFWIAHPGGPAILDQV           KATR+VLSEYGNMSSACVLFILDEMRKKSA+    TTGEGLDWGVLFGFGPGLT+ETVVLHSV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPIPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKDVPGIVSKNIDKALVEAFQPLNISDYNSIFWIAHPGGPAILDQVEQKLGLKPEKMKATREVLSEYGNMSSACVLFILDEMRKKSAQAGLKTTGEGLDWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS3_TRISU (Chalcone synthase 3 OS=Trifolium subterraneum GN=CHS3 PE=2 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 1.375e-96
Identity = 176/232 (75.86%), Postives = 195/232 (84.05%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+P++ +V T+QTI PDS+GAIDGHLRE GLTFHLLKDVPG++SKNI+K+L EAF P+GISD+NSIFWIAHPGGPAILDQV           KATR+VLSEYGNMSSACVLFILDEMRKKS ++   TTGEGLDWGVLFGFGPGLT+ETVVLHSV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPIFVMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKDVPGIVSKNIDKALVEAFQPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMKATREVLSEYGNMSSACVLFILDEMRKKSTKDGLKTTGEGLDWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS6_TRISU (Chalcone synthase 6 OS=Trifolium subterraneum GN=CHS6 PE=2 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 1.796e-96
Identity = 176/232 (75.86%), Postives = 194/232 (83.62%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLKDVPG++SKNI+K+L EAF P+ ISD+NSIFWIAHPGGPAILDQV           KATR VLSEYGNMSSACVLFILDEMRKKSA+    TTGEGLDWGVLFGFGPGLT+ETVVLHSV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKDVPGIVSKNIDKALVEAFQPLNISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMKATRDVLSEYGNMSSACVLFILDEMRKKSAQNGLKTTGEGLDWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS5_TRISU (Chalcone synthase 5 OS=Trifolium subterraneum GN=CHS5 PE=2 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 1.796e-96
Identity = 176/232 (75.86%), Postives = 194/232 (83.62%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLKDVPG++SKNI+K+L EAF P+ ISD+NSIFWIAHPGGPAILDQV           KATR VLSEYGNMSSACVLFILDEMRKKSA+    TTGEGLDWGVLFGFGPGLT+ETVVLHSV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKDVPGIVSKNIDKALVEAFQPLNISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMKATRDVLSEYGNMSSACVLFILDEMRKKSAQNGLKTTGEGLDWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS3_SOYBN (Chalcone synthase 3 OS=Glycine max GN=CHS3 PE=3 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 1.796e-96
Identity = 183/232 (78.88%), Postives = 193/232 (83.19%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDSLVGQALF           DP   VE+PL+QLV T+QTILPDS+GAIDGHL EVGLTFHLLKDVPGLISKNIEK+L EAF P+GISD+NSIFWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILD+MRKKS E    TTGEGLDWGVLFGFGPGLTVETVVL SV +
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDP-LPVEKPLFQLVWTAQTILPDSEGAIDGHLGEVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFWIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGTTGEGLDWGVLFGFGPGLTVETVVLRSVTV 388          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_PUELO (Chalcone synthase OS=Pueraria lobata GN=CHS PE=2 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 3.063e-96
Identity = 179/232 (77.16%), Postives = 194/232 (83.62%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DP   VE+PLY+LV T+QTI PDS+GAIDGHLREVGLTFHLLKDVPG++SKNI+K+L EAF P+ ISD+NSIFWIAHPGGPAILDQV           KATR VLS+YGNMSSACVLFILDEMR+KSAE    TTGEGL+WGVLFGFGPGLT+ETVVL SV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPQVEKPLYELVWTAQTIAPDSEGAIDGHLREVGLTFHLLKDVPGIVSKNIDKALFEAFNPLNISDYNSIFWIAHPGGPAILDQVEQKLGLKPEKMKATRDVLSDYGNMSSACVLFILDEMRRKSAENGLKTTGEGLEWGVLFGFGPGLTIETVVLRSVAI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_PHAVU (Chalcone synthase 17 OS=Phaseolus vulgaris GN=CHS17 PE=2 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 3.063e-96
Identity = 178/232 (76.72%), Postives = 194/232 (83.62%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DP   +E+PL++LV T+QTI PDSDGAIDGHLREVGLTFHLLKDVPG++SKNI K+L EAF P+ ISD+NSIFWIAHPGGPAILDQV           KATR VLS+YGNMS ACVLFILDEMR+KSAE+   TTGEGL+WGVLFGFGPGLT+ETVVLHSV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPQIEKPLFELVWTAQTIAPDSDGAIDGHLREVGLTFHLLKDVPGIVSKNIGKALFEAFNPLNISDYNSIFWIAHPGGPAILDQVEQKLGLKPEKMKATRDVLSDYGNMSGACVLFILDEMRRKSAEKGLKTTGEGLEWGVLFGFGPGLTIETVVLHSVAI 389          
The following BLAST results are available for this feature:
BLAST of CF835317 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 147
Match NameE-valueIdentityDescription
CHS5_SOYBN2.770e-9779.31Chalcone synthase 5 OS=Glycine max GN=CHS5 PE=3 SV... [more]
CHS1_SOYBN3.618e-9779.31Chalcone synthase 1 OS=Glycine max GN=CHS1 PE=3 SV... [more]
CHS6_MEDSA1.053e-9675.43Chalcone synthase 6-4 (Fragment) OS=Medicago sativ... [more]
CHS9_MEDSA1.375e-9675.86Chalcone synthase 9 OS=Medicago sativa GN=CHS9 PE=... [more]
CHS3_TRISU1.375e-9675.86Chalcone synthase 3 OS=Trifolium subterraneum GN=C... [more]
CHS6_TRISU1.796e-9675.86Chalcone synthase 6 OS=Trifolium subterraneum GN=C... [more]
CHS5_TRISU1.796e-9675.86Chalcone synthase 5 OS=Trifolium subterraneum GN=C... [more]
CHS3_SOYBN1.796e-9678.88Chalcone synthase 3 OS=Glycine max GN=CHS3 PE=3 SV... [more]
CHSY_PUELO3.063e-9677.16Chalcone synthase OS=Pueraria lobata GN=CHS PE=2 S... [more]
CHSY_PHAVU3.063e-9676.72Chalcone synthase 17 OS=Phaseolus vulgaris GN=CHS1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A15_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A15, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835317 ID=CF835317|Name=CF835317|organism=Citrus sinensis|type=EST|length=849bp
TTTTGACGTCATCAGTGAAAAGGTACGATGCCTTAAATTCAATTGACAAA
ACTAAACCTTCACACGATCAACCAATAATTCAAGAGTGAAAGCATACAAC
ATAAAGTTACTGAACTACTAAACATACTGATGGAGTTCTCACTTCAAGCT
TTGATGGGGACACTGTGCAGCACAACGGTCTCGACGGTGAGCCCCGGCCC
GAACCCGAACAGCACACCCCAATCTAGCCCTTCGCCGGTGGTGGCTTTCG
CTTCCTCAGCAGACTTCTTTCTCATCTCGTCAAGGATGAACAGGACACAA
GCGCTTGACATGTTACCGTACTCACTCAACACTTGACGTGTGGCCTTCAG
CTTCTCCTCTTTGAGGCCGAGTTTAGACTCCACTTGGTCCAGAATTGCGG
GCCCACCGGGGTGAGCGATCCAGAATATCGAGTTCCAGTCGCTGATGCCA
ACCGGGGCGAACGCTTCCGACAGGCTTTTCTCTATATTCTTTGAGATCAA
GCCGGGGACGTCTTTAAGCAAATGGAAAGTGAGACCGACTTCGCGCAAGT
GTCCGTCAATTGCACCGTCAGAGTCAGGGAGGATCGTCTGCGAAGTCGAC
ACAAGCTGATACAACGGACGCTCGACCGACGTGTCAGGATCGGCACCCAC
GATCACAGCAGCAGCACCATCACCGAACAAAGCCTGGCCCACAAGAGAAT
CAAGATGAGTATCGGCAGGGCCGCGGAAAGTGACCGCCGTGATCTCCGAA
CAGACAACAAGAACGCGAGCGCCCTTGTTGTTCTCAGCCAAGTCTTTAGC
GAGGCGAAGAACAGTGCCGCCGGCGAAACATCCTTGNTGGTACATCATG
back to top