CF835317

Overview
NameCF835317
Unique NameCF835317
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length849
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9291 contig Csv1_Contig9291:524..1372. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS4_IPOBA (Chalcone synthase LF4 OS=Ipomoea batatas GN=CHS-LF4 PE=2 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 7.544e-95
Identity = 175/233 (75.11%), Postives = 190/233 (81.55%), Query Frame = -2
Query:  150 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIK 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVL+VCSEIT VTFRGP++THLDSLVGQALF           DP T  E+PL+QLVS +Q + PDS GAIDGHLREVGLTFHLLKDVP ++S NIEK L EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK S+     TTGEGL+WGVLFGFGPGLT+ETVVLHSVPIK
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADP-TPAEKPLFQLVSAAQNLAPDSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPIK 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_PINSY (Chalcone synthase OS=Pinus sylvestris GN=CHS PE=3 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 9.853e-95
Identity = 177/232 (76.29%), Postives = 191/232 (82.33%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDS+VGQALF           DP   VE+P ++L+ T+QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF   GISDWN +FWIAHPGGPAILDQV            ATRQVLS+YGNMSSACV FILDEMRK S E+  +TTGEGLD GVLFGFGPGLTVETVVL SVP+
Sbjct:  163 MMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAALIVGADPVPEVEKPCFELMWTAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQQFGISDWNQLFWIAHPGGPAILDQVEAKLNLDPKKLSATRQVLSDYGNMSSACVHFILDEMRKSSKEKGCSTTGEGLDVGVLFGFGPGLTVETVVLKSVPL 394          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS6_SOYBN (Chalcone synthase 6 OS=Glycine max GN=CHS6 PE=3 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 1.287e-94
Identity = 178/232 (76.72%), Postives = 192/232 (82.76%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENN GARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DP    E+PL++LV T+QTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNI+K+L EAF P+GI D+NSIFWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILD+MRKKS E    TTGEGL+WGVLFGFGPGLTVETVVL SV +
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNTGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDP-LPAEKPLFELVWTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIQKALVEAFQPLGIDDYNSIFWIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGTTGEGLEWGVLFGFGPGLTVETVVLRSVTV 388          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_PINST (Chalcone synthase OS=Pinus strobus GN=CHS PE=2 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.681e-94
Identity = 176/233 (75.54%), Postives = 192/233 (82.40%), Query Frame = -2
Query:  150 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIK 848
            MMY QGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDS+VGQALF           DP   VE+P ++++ T+QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF   GISDWN +FWIAHPGGPAILDQV           +ATRQVLSEYGNMSSACV FILDEMRK S +   +TTGEGLD GVLFGFGPGLTVETVVL SVP++
Sbjct:  163 MMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDGARALIVGADPVPEVEKPCFEMLWTAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQQFGISDWNQLFWIAHPGGPAILDQVEAKLNLDPKKLRATRQVLSEYGNMSSACVHFILDEMRKSSQQNGCSTTGEGLDVGVLFGFGPGLTVETVVLKSVPLQ 395          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS2_PEA (Chalcone synthase 2 OS=Pisum sativum GN=CHS2 PE=2 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.681e-94
Identity = 171/232 (73.71%), Postives = 193/232 (83.19%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTV RLAKDLAENNK ARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLKDVPG++SKNI+K+L EAF P+GISD+NSIFWIAHPGGPAILDQV           +ATR+VLSEYGNMSSACVLFILDEMRKKS ++   TTGEGL+WGVLFGFGPGLT+ETVVL SV I
Sbjct:  158 MMYQQGCFAGGTVFRLAKDLAENNKNARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKDVPGIVSKNIDKALVEAFKPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMRATREVLSEYGNMSSACVLFILDEMRKKSTQDGLNTTGEGLEWGVLFGFGPGLTIETVVLRSVAI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSD_IPONI (Chalcone synthase D OS=Ipomoea nil GN=CHSD PE=2 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 2.195e-94
Identity = 175/231 (75.76%), Postives = 189/231 (81.82%), Query Frame = -2
Query:  156 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVP 848
            MMY QGCFAGGTVLR+AKDLAENNK ARVLVVCSEIT VTFRGP +THLDSLVGQALF           DP T  E+PL+QLVS +QT+ PDS GAIDGHLREVGLTFHLLKDVP ++S NIEK LSEAF P+GISDWNSIFWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK S+ +   TTGEGL+WGVLFGFGPGLT+ETVVLHSVP
Sbjct:  158 MMYQQGCFAGGTVLRVAKDLAENNKAARVLVVCSEITVVTFRGPNETHLDSLVGQALFGDGAAAIIVGSDP-TPAEKPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPSIVSNNIEKCLSEAFNPLGISDWNSIFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVP 387          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS1_MEDSA (Chalcone synthase 1 OS=Medicago sativa GN=CHS1 PE=2 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 2.867e-94
Identity = 173/232 (74.57%), Postives = 191/232 (82.33%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE T VTFRGP+DTHLDSLVGQALF           DP   +E+P++++V T+ TI PDS+GAIDGHLRE GLTFHLLKDVPG++SKNI+K+L EAF P+ ISD+NSIFWIAHPGGPAILDQV           KATR+VLSEYGNMSSACVLFILDEMRKKS +    TTGEGLDWGVLFGFGPGLT+ETVVLHSV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEETPVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPIPEIEKPIFEMVWTAHTIAPDSEGAIDGHLREAGLTFHLLKDVPGIVSKNIDKALIEAFQPLNISDYNSIFWIAHPGGPAILDQVEEKLGLKPEKMKATREVLSEYGNMSSACVLFILDEMRKKSVQAGLKTTGEGLDWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_DIACA (Chalcone synthase OS=Dianthus caryophyllus GN=CHS PE=2 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 3.744e-94
Identity = 168/232 (72.41%), Postives = 188/232 (81.03%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            M+Y QGCFAGGTVLRLAKDLAENNK ARVLVVCSEITA+ FRGP +  LDS+VGQALF           DPD S+ERPL+Q+    QT+LPDSDGAIDGHLREVGLTFHLLKDVPG+ISKNI  +L +AF+P+G+SDWN++FWIAHPGGPAILDQV            ATR VLS++GNMSSACVLFILDEMRKKS  +   TTGEGLDWGVLFGFGP LTVETVVLHSVP+
Sbjct:  158 MLYQQGCFAGGTVLRLAKDLAENNKDARVLVVCSEITAICFRGPTEAALDSMVGQALFGDGAGALIVGSDPDLSIERPLFQMAWAGQTLLPDSDGAIDGHLREVGLTFHLLKDVPGIISKNITNALEDAFSPIGVSDWNNLFWIAHPGGPAILDQVEAKLGLKEEKLAATRNVLSDFGNMSSACVLFILDEMRKKSLRDGATTTGEGLDWGVLFGFGPSLTVETVVLHSVPL 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS3_IPOBA (Chalcone synthase LF3 OS=Ipomoea batatas GN=CHS-LF3 PE=2 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 3.744e-94
Identity = 173/231 (74.89%), Postives = 189/231 (81.82%), Query Frame = -2
Query:  156 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVP 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVL+VCSEIT VTFRGP++ HLDSLVGQALF           DP T  E+PL+QLVS +QT+ PDS GAIDGHLREVGLTFHLLKDVP ++S NIEK L EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK S+ +   TTGEGL+WGVLFGFGPGLT+ETVVLHSVP
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSEAHLDSLVGQALFGDGAAAVIVGADP-TPAEKPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVP 387          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS1_IPOBA (Chalcone synthase LF1 OS=Ipomoea batatas GN=CHS-LF1 PE=2 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 3.744e-94
Identity = 174/233 (74.68%), Postives = 190/233 (81.55%), Query Frame = -2
Query:  150 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIK 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVL+VCSEIT VTFRGP++THLDSLVGQALF           DP T  E+PL+QLVS +QT+ P+S GAIDGHLREVGLTFHLLKDVP ++S  IEK L EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK S+     TTGEGL+WGVLFGFGPGLT+ETVVLHSVPIK
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADP-TPAEKPLFQLVSAAQTLAPNSCGAIDGHLREVGLTFHLLKDVPSVVSNKIEKCLFEAFNPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPIK 389          
The following BLAST results are available for this feature:
BLAST of CF835317 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 147
Match NameE-valueIdentityDescription
CHS4_IPOBA7.544e-9575.11Chalcone synthase LF4 OS=Ipomoea batatas GN=CHS-LF... [more]
CHSY_PINSY9.853e-9576.29Chalcone synthase OS=Pinus sylvestris GN=CHS PE=3 ... [more]
CHS6_SOYBN1.287e-9476.72Chalcone synthase 6 OS=Glycine max GN=CHS6 PE=3 SV... [more]
CHSY_PINST1.681e-9475.54Chalcone synthase OS=Pinus strobus GN=CHS PE=2 SV=... [more]
CHS2_PEA1.681e-9473.71Chalcone synthase 2 OS=Pisum sativum GN=CHS2 PE=2 ... [more]
CHSD_IPONI2.195e-9475.76Chalcone synthase D OS=Ipomoea nil GN=CHSD PE=2 SV... [more]
CHS1_MEDSA2.867e-9474.57Chalcone synthase 1 OS=Medicago sativa GN=CHS1 PE=... [more]
CHSY_DIACA3.744e-9472.41Chalcone synthase OS=Dianthus caryophyllus GN=CHS ... [more]
CHS3_IPOBA3.744e-9474.89Chalcone synthase LF3 OS=Ipomoea batatas GN=CHS-LF... [more]
CHS1_IPOBA3.744e-9474.68Chalcone synthase LF1 OS=Ipomoea batatas GN=CHS-LF... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A15_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A15, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835317 ID=CF835317|Name=CF835317|organism=Citrus sinensis|type=EST|length=849bp
TTTTGACGTCATCAGTGAAAAGGTACGATGCCTTAAATTCAATTGACAAA
ACTAAACCTTCACACGATCAACCAATAATTCAAGAGTGAAAGCATACAAC
ATAAAGTTACTGAACTACTAAACATACTGATGGAGTTCTCACTTCAAGCT
TTGATGGGGACACTGTGCAGCACAACGGTCTCGACGGTGAGCCCCGGCCC
GAACCCGAACAGCACACCCCAATCTAGCCCTTCGCCGGTGGTGGCTTTCG
CTTCCTCAGCAGACTTCTTTCTCATCTCGTCAAGGATGAACAGGACACAA
GCGCTTGACATGTTACCGTACTCACTCAACACTTGACGTGTGGCCTTCAG
CTTCTCCTCTTTGAGGCCGAGTTTAGACTCCACTTGGTCCAGAATTGCGG
GCCCACCGGGGTGAGCGATCCAGAATATCGAGTTCCAGTCGCTGATGCCA
ACCGGGGCGAACGCTTCCGACAGGCTTTTCTCTATATTCTTTGAGATCAA
GCCGGGGACGTCTTTAAGCAAATGGAAAGTGAGACCGACTTCGCGCAAGT
GTCCGTCAATTGCACCGTCAGAGTCAGGGAGGATCGTCTGCGAAGTCGAC
ACAAGCTGATACAACGGACGCTCGACCGACGTGTCAGGATCGGCACCCAC
GATCACAGCAGCAGCACCATCACCGAACAAAGCCTGGCCCACAAGAGAAT
CAAGATGAGTATCGGCAGGGCCGCGGAAAGTGACCGCCGTGATCTCCGAA
CAGACAACAAGAACGCGAGCGCCCTTGTTGTTCTCAGCCAAGTCTTTAGC
GAGGCGAAGAACAGTGCCGCCGGCGAAACATCCTTGNTGGTACATCATG
back to top