CF835384

Overview
NameCF835384
Unique NameCF835384
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length798
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9540 contig Csv1_Contig9540:228..1025. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB2A_PINSY (Chlorophyll a-b binding protein type 2 member 1A, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 444.506 bits (1142), Expect = 3.151e-124
Identity = 207/219 (94.52%), Postives = 215/219 (98.17%), Query Frame = -3
Query:  137 SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 793
            SPWYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLG+P LIHAQSILAIWACQV+LMGA+EGYR+AGGPLGEVTDP+YPGG+FDPLGLADDP+AFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPVNNNAWAYATNFVPGK
Sbjct:   60 SPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK 278          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB23_NICPL (Chlorophyll a-b binding protein C, chloroplastic OS=Nicotiana plumbaginifolia GN=CABC PE=3 SV=1)

HSP 1 Score: 443.351 bits (1139), Expect = 7.019e-124
Identity = 208/219 (94.98%), Postives = 214/219 (97.72%), Query Frame = -3
Query:  137 SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 793
            SPWYGP+RVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK G+QIFS+GGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AG PLGEV DPLYPGGSFDPLGLA+DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct:   49 SPWYGPNRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKGGSQIFSQGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGEPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 267          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB22_PEA (Chlorophyll a-b binding protein AB80, chloroplastic OS=Pisum sativum GN=AB80 PE=1 SV=1)

HSP 1 Score: 442.965 bits (1138), Expect = 9.167e-124
Identity = 208/220 (94.55%), Postives = 215/220 (97.73%), Query Frame = -3
Query:  137 GSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 796
            GSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct:   50 GSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 269          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB21_PETSP (Chlorophyll a-b binding protein 13, chloroplastic OS=Petunia sp. GN=CAB13 PE=3 SV=1)

HSP 1 Score: 442.965 bits (1138), Expect = 9.167e-124
Identity = 207/220 (94.09%), Postives = 213/220 (96.82%), Query Frame = -3
Query:  137 GSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 796
            GSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADP TFAKNR+LEVIHCRW MLGALGCVFPEL ARNGVKFGEAVWFKAG+QIF EGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLADDPEAFAEL+VKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct:   47 GSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPATFAKNRKLEVIHCRWTMLGALGCVFPELFARNGVKFGEAVWFKAGSQIFKEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLADDPEAFAELEVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 266          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB2A_PYRPY (Chlorophyll a-b binding protein 1A, chloroplastic OS=Pyrus pyrifolia PE=2 SV=1)

HSP 1 Score: 442.58 bits (1137), Expect = 1.197e-123
Identity = 205/219 (93.61%), Postives = 215/219 (98.17%), Query Frame = -3
Query:  137 SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 793
            SPWYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLG+P LIHAQSILAIWACQV+LMGA+EGYR+AGGPLGEVTDP+YPGG+FDPLGLADDP+AFA++KVKEIKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPVNNNAWAYATNFVPGK
Sbjct:   60 SPWYGPDRVMYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFADVKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK 278          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB21_SOYBN (Chlorophyll a-b binding protein, chloroplastic (Fragment) OS=Glycine max PE=2 SV=1)

HSP 1 Score: 442.58 bits (1137), Expect = 1.197e-123
Identity = 210/220 (95.45%), Postives = 214/220 (97.27%), Query Frame = -3
Query:  137 GSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 796
            GSPWYGPDRVKYLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEA WFKAG+QIFSEGGLDYLGN SLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGEVTDP+YPGGSFDPL LADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLA+PVNNNAWAYATNFVPGK
Sbjct:   26 GSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEASWFKAGSQIFSEGGLDYLGNQSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLALADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLAEPVNNNAWAYATNFVPGK 245          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB28_PEA (Chlorophyll a-b binding protein 8, chloroplastic OS=Pisum sativum GN=CAB8 PE=1 SV=1)

HSP 1 Score: 441.81 bits (1135), Expect = 2.042e-123
Identity = 207/220 (94.09%), Postives = 215/220 (97.73%), Query Frame = -3
Query:  137 GSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 796
            GSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPVNNNAW+YATNFVPGK
Sbjct:   49 GSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK 268          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB22_HORVU (Chlorophyll a-b binding protein 2, chloroplastic OS=Hordeum vulgare GN=CAB2 PE=3 SV=1)

HSP 1 Score: 441.425 bits (1134), Expect = 2.667e-123
Identity = 209/220 (95.00%), Postives = 213/220 (96.82%), Query Frame = -3
Query:  137 GSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 796
            GSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFK G+QIFSEGGL YLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLADD EAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct:   45 GSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLGALGCVFPELLARNGVKFGEAVWFKKGSQIFSEGGLQYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDAEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 264          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB22_PETSP (Chlorophyll a-b binding protein 22L, chloroplastic OS=Petunia sp. GN=CAB22L PE=3 SV=1)

HSP 1 Score: 437.573 bits (1124), Expect = 3.851e-122
Identity = 204/220 (92.73%), Postives = 211/220 (95.91%), Query Frame = -3
Query:  137 GSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 796
            GSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL ARNGVKFGEAVW KAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLG V DPLYPGGSFDPLGLA+DPEAFAELKVKE KNGRLAMFSMFGFF+QAIVTGKGPLENLADHL DPVNNNAW+YATNFVP K
Sbjct:   48 GSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFGEAVWLKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVLLMGAVEGYRVAGGPLGVVVDPLYPGGSFDPLGLAEDPEAFAELKVKETKNGRLAMFSMFGFFIQAIVTGKGPLENLADHLVDPVNNNAWSYATNFVPRK 267          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB21_SINAL (Chlorophyll a-b binding protein 1, chloroplastic OS=Sinapis alba GN=CAB1 PE=3 SV=1)

HSP 1 Score: 434.876 bits (1117), Expect = 2.496e-121
Identity = 207/221 (93.67%), Postives = 213/221 (96.38%), Query Frame = -3
Query:  137 GSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG-GPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 796
            GSPWYG DRVKYLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AG GPLGE  D LYPGGSFDPLGLA DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct:   46 GSPWYGSDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGEGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 266          
The following BLAST results are available for this feature:
BLAST of CF835384 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 84
Match NameE-valueIdentityDescription
CB2A_PINSY3.151e-12494.52Chlorophyll a-b binding protein type 2 member 1A, ... [more]
CB23_NICPL7.019e-12494.98Chlorophyll a-b binding protein C, chloroplastic O... [more]
CB22_PEA9.167e-12494.55Chlorophyll a-b binding protein AB80, chloroplasti... [more]
CB21_PETSP9.167e-12494.09Chlorophyll a-b binding protein 13, chloroplastic ... [more]
CB2A_PYRPY1.197e-12393.61Chlorophyll a-b binding protein 1A, chloroplastic ... [more]
CB21_SOYBN1.197e-12395.45Chlorophyll a-b binding protein, chloroplastic (Fr... [more]
CB28_PEA2.042e-12394.09Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB22_HORVU2.667e-12395.00Chlorophyll a-b binding protein 2, chloroplastic O... [more]
CB22_PETSP3.851e-12292.73Chlorophyll a-b binding protein 22L, chloroplastic... [more]
CB21_SINAL2.496e-12193.67Chlorophyll a-b binding protein 1, chloroplastic O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C11_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835384 ID=CF835384|Name=CF835384|organism=Citrus sinensis|type=EST|length=798bp
TTTTTTTTTTTTTTTTGATCAATTGAAGCATTTTATAAATAACCATTACT
CAAATTAAAGCTTCCATGAGCTCACAACAGATTTACATGATATCCAAGAA
ACCGAAAAGAGAAAAACTCTTATCAACCGAAGCTCACTTTCCGGGGACAA
AGTTGGTGGCGTAGGCCCAGGCATTGTTATTGACAGGGTCAGCCAAGTGG
TCGGCCAAGTTCTCTAACGGTCCCTTGCCGGTGACAATGGCCTGAACGAA
GAAACCAAACATGGAGAACATAGCCAACCTTCCATTCTTGATTTCCTTAA
CCTTGAGCTCAGCAAAAGCCTCCGGGTCATCAGCCAAACCCAATGGATCA
AAGCTGCCACCTGGGTACAATGGGTCAGTCACTTCACCGAGCGGCCCTCC
AGCAATTCTGTAACCCTCAACGGCTCCCATCAAGACCACCTGGCAAGCCC
AGATGGCCAAGATGCTCTGGGCGTGGATCAAGCTTGGGTTTCCCAAGTAG
TCAAGCCCGCCCTCGCTGAAGATCTGAGCTCCCGCCTTGAACCACACAGC
CTCACCGAACTTGACTCCGTTGCGGGCCAAGAGCTCCGGGAAGACGCATC
CAAGAGCTCCCAACATGGCCCATCTGCAGTGGATGACTTCGAGTTCACGG
TTCTTGGCAAAGGTTTCTGGGTCAGCTGAAAGCCCGGCAGTGTCCCAACC
GTAGTCGCCAGGGAACTCACCAGTCAAGTAGCTTGGGGGCTCGCCAGAGA
GTGGGCCCAAGTACTTGACTCTGTCCGGGCCGTACCACGGGCTACCTG
back to top