CF835384

Overview
NameCF835384
Unique NameCF835384
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length798
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9540 contig Csv1_Contig9540:228..1025. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB21_LEMGI (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Lemna gibba PE=3 SV=1)

HSP 1 Score: 411.379 bits (1056), Expect = 2.956e-114
Identity = 192/219 (87.67%), Postives = 206/219 (94.06%), Query Frame = -3
Query:  137 SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 793
            S WYG DR K+LGP S + PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGC+FPELL++NGV+FGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG +EGYR+ GGPLGE  DPLYPGG+FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP+ENLADH+ADPV NNAWA+ATNFVPGK
Sbjct:   46 SIWYGADRPKFLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSKNGVQFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVVLMGLIEGYRVGGGPLGEGLDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHIADPVANNAWAFATNFVPGK 264          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB23_TOBAC (Chlorophyll a-b binding protein 36, chloroplastic OS=Nicotiana tabacum GN=CAB36 PE=3 SV=1)

HSP 1 Score: 410.609 bits (1054), Expect = 5.042e-114
Identity = 191/219 (87.21%), Postives = 205/219 (93.61%), Query Frame = -3
Query:  137 SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 793
            S WYG DR KYLGP S + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHCRWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+LIHAQSILA+WA QVVLMG +EGYR+ GGPLGE  D +YPGG+FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct:   47 SIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAVWASQVVLMGLIEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK 265          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB25_SOLLC (Chlorophyll a-b binding protein 5, chloroplastic (Fragment) OS=Solanum lycopersicum GN=CAB5 PE=2 SV=1)

HSP 1 Score: 410.223 bits (1053), Expect = 6.585e-114
Identity = 192/219 (87.67%), Postives = 205/219 (93.61%), Query Frame = -3
Query:  137 SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 793
            S WYG DR KYLGP S + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHCRWAMLGALGCVFPE+L++NGV FGEAVWFKAG+QIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GGPLGE  D +YPGG+FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP+ENL+DH+ADPV NNAWAYATNFVPGK
Sbjct:   19 SIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHIADPVANNAWAYATNFVPGK 237          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB21_PINTH (Chlorophyll a-b binding protein type I, chloroplastic OS=Pinus thunbergii PE=2 SV=1)

HSP 1 Score: 409.838 bits (1052), Expect = 8.600e-114
Identity = 194/219 (88.58%), Postives = 202/219 (92.24%), Query Frame = -3
Query:  137 SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 793
            S WYGPDR KYLGP S   PSYLTGEFPGDYGWDTA +SADPETFAKNRELEVIHCRWAMLGALGCVFPELLA+NG+KFGEAVWFKAGAQIFSEGGLDY GNP+LIHAQSILAIWACQVVLMG +EGYR+ GG LGE  DPL PGG+FDPLGLADDPEA AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP+ENL DHLADPV NNAWAYATNFVPGK
Sbjct:   48 SIWYGPDRPKYLGPFSEGTPSYLTGEFPGDYGWDTAAVSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKNGLKFGEAVWFKAGAQIFSEGGLDYAGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGTLGEGLDPLLPGGAFDPLGLADDPEACAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVANNAWAYATNFVPGK 266          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB22_SOYBN (Chlorophyll a-b binding protein 2, chloroplastic OS=Glycine max GN=CAB2 PE=3 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 1.916e-113
Identity = 199/220 (90.45%), Postives = 203/220 (92.27%), Query Frame = -3
Query:  137 GSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 796
            GSPWYGPDRVKYLGP SGE PSYLTGEF G        LSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGEVTDP+YPGGSFDPLGLADDPEA AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYAT   PGK
Sbjct:   45 GSPWYGPDRVKYLGPFSGEAPSYLTGEFHG--------LSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEALAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATKLCPGK 256          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB26_PETSP (Chlorophyll a-b binding protein 37, chloroplastic OS=Petunia sp. GN=CAB37 PE=3 SV=1)

HSP 1 Score: 407.527 bits (1046), Expect = 4.268e-113
Identity = 191/219 (87.21%), Postives = 204/219 (93.15%), Query Frame = -3
Query:  137 SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 793
            S WYG DR KYLGP S + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHCRWAMLGALGCVFPE+L++NGV FGEAVWFKAG+QIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GGPLGE  D +YPGG+FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWA+ATNFVPGK
Sbjct:   47 SIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAAQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHVADPVANNAWAFATNFVPGK 265          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB23_ORYSJ (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. japonica GN=RCABP89 PE=2 SV=1)

HSP 1 Score: 407.142 bits (1045), Expect = 5.574e-113
Identity = 190/219 (86.76%), Postives = 204/219 (93.15%), Query Frame = -3
Query:  137 SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 793
            S WYGPDR KYLGP S + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GGPLGE  D +YPGG+FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct:   45 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK 263          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB23_ORYSI (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_012078 PE=2 SV=1)

HSP 1 Score: 407.142 bits (1045), Expect = 5.574e-113
Identity = 190/219 (86.76%), Postives = 204/219 (93.15%), Query Frame = -3
Query:  137 SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 793
            S WYGPDR KYLGP S + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GGPLGE  D +YPGG+FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct:   45 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK 263          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB2_PHYPA (Chlorophyll a-b binding protein, chloroplastic OS=Physcomitrella patens PE=3 SV=1)

HSP 1 Score: 405.601 bits (1041), Expect = 1.622e-112
Identity = 191/216 (88.43%), Postives = 201/216 (93.06%), Query Frame = -3
Query:  140 WYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG 787
            WYG DR K+LGP SGE PSYL GEF GDYGWDTAGLS+DPETFA+NRELEVIH RWAMLGALGC+ PELLA++GVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEVTDP+YPGGSFDPLGLADDP+ FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENL DHLADPV NNAWAYA    PG
Sbjct:   52 WYGADRPKFLGPFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLAKSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLNDHLADPVANNAWAYAPTSPPG 267          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB215_PEA (Chlorophyll a-b binding protein 215, chloroplastic OS=Pisum sativum GN=CAB215 PE=1 SV=1)

HSP 1 Score: 403.29 bits (1035), Expect = 8.049e-112
Identity = 188/219 (85.84%), Postives = 204/219 (93.15%), Query Frame = -3
Query:  137 SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 793
            S WYGPDR KYLGP S + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGC FPELL +NGVKFGEAVWFKAG+QIF+EGGLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GGPLGE  DPLYPGG+FDPLGLADDP++FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP++NL DH+ADPV NNAWA+ATNFVPG+
Sbjct:   47 SIWYGPDRPKYLGPFSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPELLEKNGVKFGEAVWFKAGSQIFAEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGGPLGEGLDPLYPGGAFDPLGLADDPDSFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIQNLYDHVADPVANNAWAFATNFVPGQ 265          
The following BLAST results are available for this feature:
BLAST of CF835384 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 84
Match NameE-valueIdentityDescription
CB21_LEMGI2.956e-11487.67Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB23_TOBAC5.042e-11487.21Chlorophyll a-b binding protein 36, chloroplastic ... [more]
CB25_SOLLC6.585e-11487.67Chlorophyll a-b binding protein 5, chloroplastic (... [more]
CB21_PINTH8.600e-11488.58Chlorophyll a-b binding protein type I, chloroplas... [more]
CB22_SOYBN1.916e-11390.45Chlorophyll a-b binding protein 2, chloroplastic O... [more]
CB26_PETSP4.268e-11387.21Chlorophyll a-b binding protein 37, chloroplastic ... [more]
CB23_ORYSJ5.574e-11386.76Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB23_ORYSI5.574e-11386.76Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB2_PHYPA1.622e-11288.43Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB215_PEA8.049e-11285.84Chlorophyll a-b binding protein 215, chloroplastic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C11_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835384 ID=CF835384|Name=CF835384|organism=Citrus sinensis|type=EST|length=798bp
TTTTTTTTTTTTTTTTGATCAATTGAAGCATTTTATAAATAACCATTACT
CAAATTAAAGCTTCCATGAGCTCACAACAGATTTACATGATATCCAAGAA
ACCGAAAAGAGAAAAACTCTTATCAACCGAAGCTCACTTTCCGGGGACAA
AGTTGGTGGCGTAGGCCCAGGCATTGTTATTGACAGGGTCAGCCAAGTGG
TCGGCCAAGTTCTCTAACGGTCCCTTGCCGGTGACAATGGCCTGAACGAA
GAAACCAAACATGGAGAACATAGCCAACCTTCCATTCTTGATTTCCTTAA
CCTTGAGCTCAGCAAAAGCCTCCGGGTCATCAGCCAAACCCAATGGATCA
AAGCTGCCACCTGGGTACAATGGGTCAGTCACTTCACCGAGCGGCCCTCC
AGCAATTCTGTAACCCTCAACGGCTCCCATCAAGACCACCTGGCAAGCCC
AGATGGCCAAGATGCTCTGGGCGTGGATCAAGCTTGGGTTTCCCAAGTAG
TCAAGCCCGCCCTCGCTGAAGATCTGAGCTCCCGCCTTGAACCACACAGC
CTCACCGAACTTGACTCCGTTGCGGGCCAAGAGCTCCGGGAAGACGCATC
CAAGAGCTCCCAACATGGCCCATCTGCAGTGGATGACTTCGAGTTCACGG
TTCTTGGCAAAGGTTTCTGGGTCAGCTGAAAGCCCGGCAGTGTCCCAACC
GTAGTCGCCAGGGAACTCACCAGTCAAGTAGCTTGGGGGCTCGCCAGAGA
GTGGGCCCAAGTACTTGACTCTGTCCGGGCCGTACCACGGGCTACCTG
back to top