CF835384

Overview
NameCF835384
Unique NameCF835384
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length798
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9540 contig Csv1_Contig9540:228..1025. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB2_CHLMO (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Chlamydomonas moewusii PE=2 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 4.288e-97
Identity = 172/219 (78.54%), Postives = 187/219 (85.39%), Query Frame = -3
Query:  143 GSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARN-GVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVP 796
            G  WYGPDR K+LGP S   P+YLTGEFPGDYGWDTAGLSADPETF K RELEVIH RWA+LGALG + PELL+   GVKFGE VWFKAGAQIFSEGGLDYLG+P+LIHAQ+I+A  A QVVLMG +EGYR+ GGP GE  DPLYPG SFDPLGLADDP+ FAELKVKEIKNGRLAMFS FGFFVQAIVTGKGP++NLADHLADP  NNA+A AT F P
Sbjct:   36 GIEWYGPDRAKWLGPFSTNTPAYLTGEFPGDYGWDTAGLSADPETFKKYRELEVIHARWALLGALGILTPELLSTYAGVKFGEPVWFKAGAQIFSEGGLDYLGSPALIHAQNIVATLAVQVVLMGLIEGYRVNGGPAGEGLDPLYPGESFDPLGLADDPDTFAELKVKEIKNGRLAMFSCFGFFVQAIVTGKGPIQNLADHLADPGTNNAFAAATKFTP 254          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB2_CHLRE (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Chlamydomonas reinhardtii GN=cabII-1 PE=3 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 9.552e-97
Identity = 169/219 (77.17%), Postives = 189/219 (86.30%), Query Frame = -3
Query:  143 GSPWYGPDRVKYLGPLS-GEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVP 796
            G  +YGP+R K+LGP S    P+YLTGEFPGDYGWDTAGLSADPETF + RELE+IH RWAMLGALGC  PELLA++G KFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQ+I+A  A QV+LMG +EGYR+ GGP GE  DPLYPG SFDPLGLADDP+ FAELKVKEIKNGRLA FSMFGFFVQAIVTGKGP++NL DHLA+P  NNA+A+AT F P
Sbjct:   33 GVEFYGPNRAKWLGPYSENATPAYLTGEFPGDYGWDTAGLSADPETFKRYRELELIHARWAMLGALGCQTPELLAKSGTKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQNIVATSAVQVILMGLIEGYRVNGGPAGEGLDPLYPGESFDPLGLADDPDTFAELKVKEIKNGRLASFSMFGFFVQAIVTGKGPVQNLDDHLANPTVNNAFAFATKFTP 251          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB2_MALDO (Chlorophyll a-b binding protein AB10, chloroplastic OS=Malus domestica PE=3 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 2.353e-95
Identity = 176/211 (83.41%), Postives = 185/211 (87.68%), Query Frame = -3
Query:  140 RVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG 772
            RVKYLGP SGE PSYLTGEFPGDYGWDTAGLSA PETFAKNRELEVIH R AM  ALGC+FPELL+  G  FGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIW  +V+LMGAVEGYRIA GPLGEVTDPLYP GSFD LGLA+D EAFAELKVKE+KNGRLAMFSMFGFFVQAIV+ K  LENLADHL   VNNNA +  TNFVPG
Sbjct:   58 RVKYLGPFSGEWPSYLTGEFPGDYGWDTAGLSAYPETFAKNRELEVIHSRCAMSAALGCIFPELLSVMGQGFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWTTKVILMGAVEGYRIARGPLGEVTDPLYP-GSFDSLGLAEDTEAFAELKVKELKNGRLAMFSMFGFFVQAIVSRKDRLENLADHLGWTVNNNALSNVTNFVPG 267          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB23_SOLLC (Chlorophyll a-b binding protein 13, chloroplastic OS=Solanum lycopersicum GN=CAB13 PE=1 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 5.242e-95
Identity = 174/219 (79.45%), Postives = 186/219 (84.93%), Query Frame = -3
Query:  140 WYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAR-NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGP-LGEVTDPLYPGGS-FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG 787
            WYGPDRVKYLGP S + PSYL GEFPGDYGWDTAGLSADPE FAKNR LEVIH RWAMLGALGC+FPE+L +   V F E VWFKAG+QIFS+GGLDYLGNP+L+HAQSILA+   QVVLMG VEG+RI G P +GE  D LYPGG  FDPLGLADDP  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENL DHL +PV NNAW YAT FVPG
Sbjct:   47 WYGPDRVKYLGPFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGALGCIFPEVLEKWVKVDFKEPVWFKAGSQIFSDGGLDYLGNPNLVHAQSILAVLGFQVVLMGLVEGFRINGLPGVGEGND-LYPGGQYFDPLGLADDPTTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFVPG 264          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB23_HORVU (Chlorophyll a-b binding protein of LHCII type III, chloroplastic OS=Hordeum vulgare GN=LHBC PE=2 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 1.168e-94
Identity = 173/219 (79.00%), Postives = 186/219 (84.93%), Query Frame = -3
Query:  140 WYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAR-NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG-GPLGEVTDPLYPGGS-FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG 787
            WYGPDRVKYLGP S + PSYL GEFPGDYGWDTAGLSADPE FA+NR LEVIH RWAMLGALGCVFPE+L +  GV+F E VWFKAG+QIFSEGGLDYLGNP+L+HAQSILA+   QV+LMG VEG+RI G   +GE  D LYPGG  FDPLGLADDP  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENL DHL DPV NNAW +AT F PG
Sbjct:   50 WYGPDRVKYLGPFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGCVFPEVLQKWVGVEFKEPVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAVLGFQVLLMGLVEGFRINGLDGVGEGND-LYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLFDHLDDPVANNAWVFATKFAPG 267          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB2_DUNTE (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella tertiolecta PE=2 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 1.529e-86
Identity = 159/220 (72.27%), Postives = 180/220 (81.82%), Query Frame = -3
Query:  140 WYGPDRVKYLGPLS-GEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARN-GVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLG--EVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG 787
            +YGPDR K+LGP S  + P YLTGEFPGDYGWDTAGLSADP+TFA+ RE+E+IH RWA+LGALG + PELL++  GV+FGE VWFKAGAQIF++GGL+YLGN SLIHAQSI+A  A QVVLMG  E YR  GG  G  +  D LYPGG FDPLGLADDP+ FAELKVKEIKNGRLAMFS  GFFVQAIVTGKGP++NL DHLADP  N A+A AT F PG
Sbjct:   33 FYGPDRAKFLGPFSENDTPEYLTGEFPGDYGWDTAGLSADPQTFARYREIELIHARWALLGALGILTPELLSQYAGVQFGEPVWFKAGAQIFADGGLNYLGNESLIHAQSIIATLAVQVVLMGLAEAYRANGGSEGFLDDLDTLYPGGPFDPLGLADDPDTFAELKVKEIKNGRLAMFSCLGFFVQAIVTGKGPVQNLTDHLADPTVNKAFASATKFTPG 252          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB2_DUNSA (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella salina PE=2 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 1.582e-83
Identity = 155/217 (71.43%), Postives = 175/217 (80.65%), Query Frame = -3
Query:  143 WYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA-RNGVKFGEA-VWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVP 787
            +YGPD       L  + P   TGEFPGDYGWDTAGLSADPETF + RELE+IH R  +LGALG V PELLA  +G+KFG+A +WFKAGA IF +GGL+YLGNPSLIHAQ+I+A  A QVVLMG VEGYR+ GGP GE  DPLYPG +FDPLGLADDP+ FAELKVKEIKNGRLAMF+  GFFVQAIVTGKGP+ENL DHLA+P  NNA+AYAT F P
Sbjct:   57 FYGPDATSGWD-LQHQHPRLPTGEFPGDYGWDTAGLSADPETFKRYRELELIHARCGLLGALGMVTPELLADEDGIKFGDAAIWFKAGAAIFQDGGLNYLGNPSLIHAQNIVATLAVQVVLMGLVEGYRVNGGPAGEGLDPLYPGEAFDPLGLADDPDTFAELKVKEIKNGRLAMFACLGFFVQAIVTGKGPIENLTDHLANPAENNAFAYATKFTP 272          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB21_SILPR (Chlorophyll a-b binding protein, chloroplastic (Fragment) OS=Silene pratensis PE=2 SV=2)

HSP 1 Score: 308.916 bits (790), Expect = 2.066e-83
Identity = 142/160 (88.75%), Postives = 150/160 (93.75%), Query Frame = -3
Query:  314 SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF 793
            S WYGPDR KYLGP S + PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA+NGVKFGEAVWFKAG+QIF EGGLDYLGNP+L+HAQSILAIWACQVVLMGAVEGYR+ GGPLGE  D LYPGG+FDPLGLA+DPEAF
Sbjct:   46 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKNGVKFGEAVWFKAGSQIFQEGGLDYLGNPNLVHAQSILAIWACQVVLMGAVEGYRVGGGPLGEGLDQLYPGGAFDPLGLAEDPEAF 205          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB22_PINSY (Chlorophyll a-b binding protein type 2 member 2 (Fragment) OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 2.071e-75
Identity = 135/150 (90.00%), Postives = 141/150 (94.00%), Query Frame = -3
Query:  137 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 586
            ELL +NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWACQVVLMG +EGYR+ GGPLGE  DPLYPG +FDPLGLADDPEA AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP+ENL DHLADPV NNAWAYATNFVPGK
Sbjct:    1 ELLVKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGPLGEGLDPLYPGDAFDPLGLADDPEAKAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVANNAWAYATNFVPGK 150          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB2D_SOLLC (Chlorophyll a-b binding protein 1D (Fragment) OS=Solanum lycopersicum GN=CAB1D PE=3 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 4.952e-61
Identity = 112/116 (96.55%), Postives = 115/116 (99.14%), Query Frame = -3
Query:  137 SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 484
            SL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct:    1 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 116          
The following BLAST results are available for this feature:
BLAST of CF835384 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 84
Match NameE-valueIdentityDescription
CB2_CHLMO4.288e-9778.54Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB2_CHLRE9.552e-9777.17Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB2_MALDO2.353e-9583.41Chlorophyll a-b binding protein AB10, chloroplasti... [more]
CB23_SOLLC5.242e-9579.45Chlorophyll a-b binding protein 13, chloroplastic ... [more]
CB23_HORVU1.168e-9479.00Chlorophyll a-b binding protein of LHCII type III,... [more]
CB2_DUNTE1.529e-8672.27Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB2_DUNSA1.582e-8371.43Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB21_SILPR2.066e-8388.75Chlorophyll a-b binding protein, chloroplastic (Fr... [more]
CB22_PINSY2.071e-7590.00Chlorophyll a-b binding protein type 2 member 2 (F... [more]
CB2D_SOLLC4.952e-6196.55Chlorophyll a-b binding protein 1D (Fragment) OS=S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C11_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835384 ID=CF835384|Name=CF835384|organism=Citrus sinensis|type=EST|length=798bp
TTTTTTTTTTTTTTTTGATCAATTGAAGCATTTTATAAATAACCATTACT
CAAATTAAAGCTTCCATGAGCTCACAACAGATTTACATGATATCCAAGAA
ACCGAAAAGAGAAAAACTCTTATCAACCGAAGCTCACTTTCCGGGGACAA
AGTTGGTGGCGTAGGCCCAGGCATTGTTATTGACAGGGTCAGCCAAGTGG
TCGGCCAAGTTCTCTAACGGTCCCTTGCCGGTGACAATGGCCTGAACGAA
GAAACCAAACATGGAGAACATAGCCAACCTTCCATTCTTGATTTCCTTAA
CCTTGAGCTCAGCAAAAGCCTCCGGGTCATCAGCCAAACCCAATGGATCA
AAGCTGCCACCTGGGTACAATGGGTCAGTCACTTCACCGAGCGGCCCTCC
AGCAATTCTGTAACCCTCAACGGCTCCCATCAAGACCACCTGGCAAGCCC
AGATGGCCAAGATGCTCTGGGCGTGGATCAAGCTTGGGTTTCCCAAGTAG
TCAAGCCCGCCCTCGCTGAAGATCTGAGCTCCCGCCTTGAACCACACAGC
CTCACCGAACTTGACTCCGTTGCGGGCCAAGAGCTCCGGGAAGACGCATC
CAAGAGCTCCCAACATGGCCCATCTGCAGTGGATGACTTCGAGTTCACGG
TTCTTGGCAAAGGTTTCTGGGTCAGCTGAAAGCCCGGCAGTGTCCCAACC
GTAGTCGCCAGGGAACTCACCAGTCAAGTAGCTTGGGGGCTCGCCAGAGA
GTGGGCCCAAGTACTTGACTCTGTCCGGGCCGTACCACGGGCTACCTG
back to top