CF835384

Overview
NameCF835384
Unique NameCF835384
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length798
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9540 contig Csv1_Contig9540:228..1025. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB13_SOLLC (Chlorophyll a-b binding protein 8, chloroplastic OS=Solanum lycopersicum GN=CAB8 PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 3.130e-31
Identity = 90/212 (42.45%), Postives = 117/212 (55.19%), Query Frame = -3
Query:  173 SYLTGEFPGDYGWDTAGLSADPET---FAKNREL---EVIHCRWAMLGALGCVFPELLARNGVKFGEAV--WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGP----------------LGEVTDPLYPGGS-FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 733
            SYL G  PGD+G+D  GLS DPE    F + + L   EVI+ R+AMLGA G + PE+L + G+   E    WF+ G  I   G  +Y  +           ++  ++ LMG  E  R                     LG   DP YPGG  F+PLG   D ++  ELK+KEIKNGRLAM ++ G+F+QA+VTG GP +NL DHLADPVNNN
Sbjct:   64 SYLDGRLPGDFGFDPLGLS-DPEGTGGFIEPKWLAYGEVINGRFAMLGAAGAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADN--------YTLFVLEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGLGGSGDPAYPGGPLFNPLGFGKDEKSMKELKLKEIKNGRLAMLAILGYFIQALVTGVGPYQNLLDHLADPVNNN 265          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB12_PETHY (Chlorophyll a-b binding protein, chloroplastic OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.650e-30
Identity = 79/192 (41.15%), Postives = 103/192 (53.65%), Query Frame = -3
Query:  185 PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA-----CQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS-FDPLGL-ADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP 739
            PP +L G  PGD+G+D  GL +DPE+   N + E++H RWAMLGA G   PE L + GV      W+ AG Q +      +    +L   + +L  WA       ++  G V    I        TD  YPGG  FDPLG  +  P    EL+ KEIKNGRLAM ++ G + Q I TG GP++NL  HLADP
Sbjct:   74 PPEWLDGSLPGDFGFDPLGLGSDPESLKWNAQAELVHSRWAMLGAAGIFIPEFLTKIGV-LNTPSWYTAGEQEY------FTDTTTLFVIELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADP 258          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB23_PEA (Chlorophyll a-b binding protein 3, chloroplastic OS=Pisum sativum GN=lhca3 PE=1 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 4.520e-30
Identity = 88/212 (41.51%), Postives = 118/212 (55.66%), Query Frame = -3
Query:  173 SYLTGEFPGDYGWDTAGLSADPET---FAKNREL---EVIHCRWAMLGALGCVFPELLARNGVKFGEAV--WFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG----GPLGEVT------------DPLYPGGSF-DPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 733
            SYL G  PGDYG+D  GLS DPE    F + R L   EVI+ R+AMLGA+G + PE L + G+   E    WF+ G  I   G  +Y  +           ++  ++ LMG  E  R       G +G+              +P YPGG F +PLG   D ++  ELK+KE+KNGRLAM ++ G+F+Q +VTG GP +NL DH+ADPVNNN
Sbjct:   66 SYLDGSLPGDYGFDPLGLS-DPEGTGGFIEPRWLAYGEVINGRFAMLGAVGAIAPEYLGKVGLIPQETALAWFQTGV-IPPAGTYNYWADN--------YTLFVLEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGFGGSGNPAYPGGPFFNPLGFGKDEKSLKELKLKEVKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHVADPVNNN 267          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB24_ARATH (Chlorophyll a-b binding protein 4, chloroplastic OS=Arabidopsis thaliana GN=CAB4 PE=1 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.567e-25
Identity = 77/191 (40.31%), Postives = 100/191 (52.36%), Query Frame = -3
Query:  176 PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGA-QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEG---YRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNN 736
            P YLTG   GD G+D  GL+ DPE      + E+++ RWAMLG  G + PE+  + G+      W+ AG  Q F+     ++    L H   I   W   +   G+V     ++    P GEV    YPGG F+PL  A   EA    K KE+ NGRLAM +  GF VQ  VTGKGP ENL  HL+DP +N
Sbjct:   64 PDYLTGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIGI-INVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRR-WQ-DIKNPGSVNQDPIFKQYSLPKGEVG---YPGGIFNPLNFAPTQEA----KEKELANGRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHN 244          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB24_PEA (Chlorophyll a-b binding protein P4, chloroplastic OS=Pisum sativum GN=lhcA-P4 PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 7.468e-25
Identity = 75/191 (39.27%), Postives = 100/191 (52.36%), Query Frame = -3
Query:  176 PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG-AQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEG---YRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNN 736
            P YLTG  PGD G+D  GL+ DPE      + E+++ RWAMLG  G + PE+    G+      W+ AG  + F+     ++    L H   I   W   +   G+V     ++    P GEV    YPGG F+PL  A   EA    K KEI NGRLAM +  GF +Q  VTGKGP +NL  H++DP +N
Sbjct:   63 PGYLTGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGI-INVPKWYAAGKEEYFASSSTLFVIEFILSHYVEIRR-WQ-DIKNPGSVNQDPIFKQYSLPAGEVG---YPGGIFNPLNFAPTLEA----KEKEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHN 243          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: LH18_EUGGR (Light-harvesting complex I LH38 proteins (Fragment) OS=Euglena gracilis PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.664e-24
Identity = 81/183 (44.26%), Postives = 99/183 (54.10%), Query Frame = -3
Query:  200 PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPL---GEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLAD 739
            PP YLTGE  GD G+D AGL+ADP TF + +  EV HCR +ML  +GC+ PELL       G   WF    QI+ +  +D+          +  A+ A QVV    +E +R  GG L    E  D  YPG  FDPL L  +       K  EIKNGRLAM  MFG  VQ+ VTGK P+ NL D
Sbjct:  380 PPRYLTGEAYGDKGFDPAGLAADPVTFERMQVAEVFHCRLSMLALVGCLVPELL-------GNGAWF----QIWDK--VDF----------NRFAVVALQVV--APLEYWRGNGGFLWNDEETVDQSYPG--FDPLNLTTE-----YTKEAEIKNGRLAMNGMFGLEVQSHVTGKSPINNLID 530          

HSP 2 Score: 112.464 bits (280), Expect = 2.838e-24
Identity = 72/195 (36.92%), Postives = 100/195 (51.28%), Query Frame = -3
Query:  173 SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGG---PLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 748
            + EPP+ LTGE+P D G+D   L+ADP+ +A+ R  EV H R AML  +GC+ PELL       G+  WF+AG  +                    L +    + +    E +R  GG     GE+ D  YPG  FDPL L  D       +  E+KNGRLA+ ++ G   Q + TG+ PL NL+ HLA+P+  N
Sbjct:  193 NAEPPALLTGEYPADRGFDPLNLAADPDVYARMRVAEVFHGRLAMLCTVGCIVPELL-------GKGAWFEAGDSVDG------------------LKLGFITMAIAAPTEYWRGQGGFNWQKGEL-DRSYPG--FDPLNLTTD-----YTRAAEVKNGRLALTAVAGLTAQYLATGESPLANLSAHLANPIGAN 354          

HSP 3 Score: 105.916 bits (263), Expect = 2.656e-22
Identity = 73/191 (38.22%), Postives = 98/191 (51.31%), Query Frame = -3
Query:  173 PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEG-YRIAGGPLGEVTDP--LYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 736
            PS+L GE+ GD G+D AGL+ADP+TF + R  EV H R AML  +G + P+ L       G+ +W++A                          I   +V +  A  G + +A G + E +DP  +YPG  FDPL L  D       K  EIKNGRLA+ ++ GF VQ  V G  PL NLA+HL  P+  N
Sbjct:   12 PSWLNGEYYGDRGFDPAGLAADPDTFERMRIAEVYHGRLAMLAVVGALVPDYL-------GKGIWYEAAQN---------------------AGIGLKEVAIFTAAYGVFEVARG-VKENSDPTTIYPG--FDPLNLTTD-----YTKEAEIKNGRLALTALLGFEVQRHVVGGSPLANLAEHLQQPLQRN 166          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB4A_ARATH (Chlorophyll a-b binding protein CP29.1, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.1 PE=1 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 3.138e-23
Identity = 88/239 (36.82%), Postives = 111/239 (46.44%), Query Frame = -3
Query:  179 YLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPE-----------TFAKN--------------------------------RELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSF-DPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVN 763
            Y G +S   P +L G   GDYG+D  GL    E             AKN                                RE E+IH RWAML  LG +  E L   GV      W  AG     +G   YLG P      +++ I   +V+++G +E  R A     +    LYPGG F DPLGLA DPE  A+L++ EIK+ RLAM +  GF VQA  TGKGPL N A HL+DP++
Sbjct:   59 YPGAIS---PDWLDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVIGTRTEAADAKSTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLT--GV-----TWQDAGKVELVDGS-SYLGQPLPFSISTLIWI---EVLVIGYIEFQRNAEL---DSEKRLYPGGKFFDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLH 280          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB4B_ARATH (Chlorophyll a-b binding protein CP29.2, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.2 PE=1 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 4.098e-23
Identity = 85/230 (36.96%), Postives = 105/230 (45.65%), Query Frame = -3
Query:  179 PSYLTGEFPGDYGWDTAGLSADPE-----------TFAKN--------------------------------RELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSF-DPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVN 736
            P YL G   GDYG+D  GL    E             AKN                                RE E+IH RWAML  LG +  E L   GV      W  AG     +G   YLG P      +++ I   +V+++G +E  R A     +    LYPGG F DPLGLA DP   A+L++ EIK+ RLAM    GF VQA  TGKGPL N A HL+DP++
Sbjct:   62 PEYLDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLYGEVIGTRTEAVDPKSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGAITVEWLT--GV-----TWQDAGKVELVDGS-SYLGQPLPFSISTLIWI---EVLVIGYIEFQRNAEL---DSEKRLYPGGKFFDPLGLASDPVKKAQLQLAEIKHARLAMVGFLGFAVQAAATGKGPLNNWATHLSDPLH 277          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB4C_ARATH (Chlorophyll a-b binding protein CP29.3, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.3 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.749e-19
Identity = 79/225 (35.11%), Postives = 98/225 (43.56%), Query Frame = -3
Query:  203 PPSYLTGEFPGDYGWDTAGLSADPE-----------TFAKN--------------------------------RELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDP---LYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLA 739
            PP +L G   GD G+D  GL    E             AKN                                RE E+IH RWAMLG LG +  E L   G+      W  AG     EG   YLG P      +++ I   +V+++G +E  R          DP   +YPGG FDPLGLA DPE    LK+ EIK+ RLAM +   F +QA  TGKGP+  LA
Sbjct:   65 PPEWLDGSMIGDRGFDPFGLGKPAEYLQYDFDGLDQNLAKNVAGDIIGIIQESSEIKPTPFQPYTEVFGIQRFRECELIHGRWAMLGTLGAIAVEALT--GI-----AWQDAGKVELVEGS-SYLGQPLPFSLTTLIWI---EVLVVGYIEFQR------NSELDPEKRIYPGGYFDPLGLAADPEKLDTLKLAEIKHSRLAMVAFLIFALQAAFTGKGPVSFLA 272          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB29_CHLRE (Chlorophyll a-b binding protein CP29 OS=Chlamydomonas reinhardtii GN=Lhcb4 PE=1 SV=3)

HSP 1 Score: 91.6633 bits (226), Expect = 5.184e-18
Identity = 85/236 (36.02%), Postives = 102/236 (43.22%), Query Frame = -3
Query:  176 PSYLTGEFPGDYGWDTAGLSADPE-----------TFAKN----------------------------------RELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDP---LYPGGSFDPLGLA-DDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNN 736
            P +L G  PGD G+D  GLS   E             AKN                                  RE E+IH RWAML  LG +  E  A  GV      W +AG       G  Y G   L    SI  +   +V+L+G  E YR         T+P    YPGG FDPL LA +D E    LK  EIK+ RLAM S FG+ VQA+ TG+G L +LA   AD +NN
Sbjct:   60 PEWLDGSLPGDRGFDPLGLSKPSEFVVIGVDENDQNAAKNNKGSVEAIVQATPDEVSSENRLAPYSEVFGLARFRECELIHGRWAMLACLGALVAE--ATTGVS-----WVEAGKVELD--GASYAG---LSLPFSITQLIWIEVILVGGAEFYR------NSETNPEKRCYPGGVFDPLKLASEDEERAFRLKTAEIKHARLAMVSFFGYGVQALSTGEGALGSLA-KFADGLNN 276          
The following BLAST results are available for this feature:
BLAST of CF835384 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 84
Match NameE-valueIdentityDescription
CB13_SOLLC3.130e-3142.45Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB12_PETHY2.650e-3041.15Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB23_PEA4.520e-3041.51Chlorophyll a-b binding protein 3, chloroplastic O... [more]
CB24_ARATH2.567e-2540.31Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB24_PEA7.468e-2539.27Chlorophyll a-b binding protein P4, chloroplastic ... [more]
LH18_EUGGR1.664e-2444.26Light-harvesting complex I LH38 proteins (Fragment... [more]
CB4A_ARATH3.138e-2336.82Chlorophyll a-b binding protein CP29.1, chloroplas... [more]
CB4B_ARATH4.098e-2336.96Chlorophyll a-b binding protein CP29.2, chloroplas... [more]
CB4C_ARATH2.749e-1935.11Chlorophyll a-b binding protein CP29.3, chloroplas... [more]
CB29_CHLRE5.184e-1836.02Chlorophyll a-b binding protein CP29 OS=Chlamydomo... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C11_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835384 ID=CF835384|Name=CF835384|organism=Citrus sinensis|type=EST|length=798bp
TTTTTTTTTTTTTTTTGATCAATTGAAGCATTTTATAAATAACCATTACT
CAAATTAAAGCTTCCATGAGCTCACAACAGATTTACATGATATCCAAGAA
ACCGAAAAGAGAAAAACTCTTATCAACCGAAGCTCACTTTCCGGGGACAA
AGTTGGTGGCGTAGGCCCAGGCATTGTTATTGACAGGGTCAGCCAAGTGG
TCGGCCAAGTTCTCTAACGGTCCCTTGCCGGTGACAATGGCCTGAACGAA
GAAACCAAACATGGAGAACATAGCCAACCTTCCATTCTTGATTTCCTTAA
CCTTGAGCTCAGCAAAAGCCTCCGGGTCATCAGCCAAACCCAATGGATCA
AAGCTGCCACCTGGGTACAATGGGTCAGTCACTTCACCGAGCGGCCCTCC
AGCAATTCTGTAACCCTCAACGGCTCCCATCAAGACCACCTGGCAAGCCC
AGATGGCCAAGATGCTCTGGGCGTGGATCAAGCTTGGGTTTCCCAAGTAG
TCAAGCCCGCCCTCGCTGAAGATCTGAGCTCCCGCCTTGAACCACACAGC
CTCACCGAACTTGACTCCGTTGCGGGCCAAGAGCTCCGGGAAGACGCATC
CAAGAGCTCCCAACATGGCCCATCTGCAGTGGATGACTTCGAGTTCACGG
TTCTTGGCAAAGGTTTCTGGGTCAGCTGAAAGCCCGGCAGTGTCCCAACC
GTAGTCGCCAGGGAACTCACCAGTCAAGTAGCTTGGGGGCTCGCCAGAGA
GTGGGCCCAAGTACTTGACTCTGTCCGGGCCGTACCACGGGCTACCTG
back to top