CF835384

Overview
NameCF835384
Unique NameCF835384
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length798
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9540 contig Csv1_Contig9540:228..1025. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB4A_SOLLC (Chlorophyll a-b binding protein CP24 10A, chloroplastic OS=Solanum lycopersicum GN=CAP10A PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.081e-15
Identity = 70/204 (34.31%), Postives = 85/204 (41.67%), Query Frame = -3
Query:  215 PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIA------------GGPLGEVTDPL--------YPGGS-FDPLGLA---------DDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL 736
            P +L G  PGDYG+D  GL  DP      RE E+IH RWAM   LG          G  +    WF+AGA            +P  I   S   +   Q++LMG VE  R                P  +  +          YPGG  FDPL LA          D E    LKV EIK+ RLAM +M  F+ +A   GK PL
Sbjct:   68 PEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFV-------GQAWSGIPWFEAGA------------DPGAIAPFSFGTLLGTQLILMGWVESKRWVDFFDPDSQSVEWATPWSKTAENFANFTGEQGYPGGKFFDPLALAGTLNNGVYVPDTEKLERLKVAEIKHARLAMLAMLIFYFEA-GQGKTPL 251          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB4B_SOLLC (Chlorophyll a-b binding protein CP24 10B, chloroplastic OS=Solanum lycopersicum GN=CAP10B PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 9.151e-15
Identity = 68/204 (33.33%), Postives = 86/204 (42.16%), Query Frame = -3
Query:  215 PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIA------------GGPLGEVTDPL--------YPGGS-FDPLGLA---------DDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL 736
            P +L G  PGD+G+D  GL  DP      RE E+IH RWAM   LG          G  +    WF+AGA            +P  I   S  ++   Q++LMG VE  R                P  +  +          YPGG  FDPL LA          D E    LK+ EIK+ RLAM +M  F+ +A   GK PL
Sbjct:   68 PEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFV-------GQAWSGIPWFEAGA------------DPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAENFANFTGEQGYPGGKFFDPLALAGTLNNGVYVPDTEKLERLKLAEIKHSRLAMLAMLIFYFEA-GQGKTPL 251          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB4_SPIOL (Chlorophyll a-b binding protein CP24, chloroplastic OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.195e-14
Identity = 68/204 (33.33%), Postives = 87/204 (42.65%), Query Frame = -3
Query:  215 PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYR--------------------IAGGPLGEVTDPLYPGGSF-DPLGLAD---------DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL 736
            P +L G  PGD+G+D  GL  DP      RE E+IH RWAML  LG    +  A  G+      WF+AGA            +P  +   S   +   Q++LMG VE  R                     A        +  YPGG F DPL LA          D +    LK+ EIK+ RLAM +M  F+ +A   GK PL
Sbjct:   73 PEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMLAVLGIFVGQ--AWTGIP-----WFEAGA------------DPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFDPDSQSVEWATPWSRTAENFSNSTGEQGYPGGKFFDPLSLAGTISNGVYNPDTDKLERLKLAEIKHARLAMLAMLIFYFEA-GQGKTPL 256          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: LH15_EUGGR (Light-harvesting complex I LH35 proteins (Fragment) OS=Euglena gracilis PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.944e-13
Identity = 67/173 (38.73%), Postives = 81/173 (46.82%), Query Frame = -3
Query:  164 PETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLG----EVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA 670
            P  + + R  EV + R AML  +GCV+PELL  NGV F   VW K     F                    A+ + QVV    +E +R  GG  G    E  D  YPG  FDP  L  +       K  EIKNGRLAM  MFG  VQ  VT +GP+ NL +HL  P+  N  A
Sbjct:    1 PTVYERMRVAEVFNGRLAMLAIVGCVYPELLG-NGVWF--EVWNKVDFYRF--------------------ALISLQVV--APLEYWRGNGG-FGWDGEEKYDRSYPG--FDPCNLTTE-----YTKAAEIKNGRLAMIGMFGLEVQNHVTAQGPVANLIEHLRHPLAANIGA 140          
The following BLAST results are available for this feature:
BLAST of CF835384 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 84
Match NameE-valueIdentityDescription
CB4A_SOLLC1.081e-1534.31Chlorophyll a-b binding protein CP24 10A, chloropl... [more]
CB4B_SOLLC9.151e-1533.33Chlorophyll a-b binding protein CP24 10B, chloropl... [more]
CB4_SPIOL1.195e-1433.33Chlorophyll a-b binding protein CP24, chloroplasti... [more]
LH15_EUGGR2.944e-1338.73Light-harvesting complex I LH35 proteins (Fragment... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C11_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835384 ID=CF835384|Name=CF835384|organism=Citrus sinensis|type=EST|length=798bp
TTTTTTTTTTTTTTTTGATCAATTGAAGCATTTTATAAATAACCATTACT
CAAATTAAAGCTTCCATGAGCTCACAACAGATTTACATGATATCCAAGAA
ACCGAAAAGAGAAAAACTCTTATCAACCGAAGCTCACTTTCCGGGGACAA
AGTTGGTGGCGTAGGCCCAGGCATTGTTATTGACAGGGTCAGCCAAGTGG
TCGGCCAAGTTCTCTAACGGTCCCTTGCCGGTGACAATGGCCTGAACGAA
GAAACCAAACATGGAGAACATAGCCAACCTTCCATTCTTGATTTCCTTAA
CCTTGAGCTCAGCAAAAGCCTCCGGGTCATCAGCCAAACCCAATGGATCA
AAGCTGCCACCTGGGTACAATGGGTCAGTCACTTCACCGAGCGGCCCTCC
AGCAATTCTGTAACCCTCAACGGCTCCCATCAAGACCACCTGGCAAGCCC
AGATGGCCAAGATGCTCTGGGCGTGGATCAAGCTTGGGTTTCCCAAGTAG
TCAAGCCCGCCCTCGCTGAAGATCTGAGCTCCCGCCTTGAACCACACAGC
CTCACCGAACTTGACTCCGTTGCGGGCCAAGAGCTCCGGGAAGACGCATC
CAAGAGCTCCCAACATGGCCCATCTGCAGTGGATGACTTCGAGTTCACGG
TTCTTGGCAAAGGTTTCTGGGTCAGCTGAAAGCCCGGCAGTGTCCCAACC
GTAGTCGCCAGGGAACTCACCAGTCAAGTAGCTTGGGGGCTCGCCAGAGA
GTGGGCCCAAGTACTTGACTCTGTCCGGGCCGTACCACGGGCTACCTG
back to top