CK740330

Overview
NameCK740330
Unique NameCK740330
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length637
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2799 contig Csv1_Contig2799:2..639. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A3_SOLLC (Eukaryotic translation initiation factor 5A-3 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 8.462e-81
Identity = 146/159 (91.82%), Postives = 153/159 (96.23%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPK 561
            MSDEEH FESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFV IDIF+GKKLEDIVPSSHN DVPHVNRTDYQLIDISEDGFVSLLT+NGNTKDDLRLPTDE LL+ +KDGFAEGKDLV++VMS+MGEEQI ALKDIGPK
Sbjct:    1 MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTDENLLSLIKDGFAEGKDLVVSVMSAMGEEQINALKDIGPK 159          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A3_SOLTU (Eukaryotic translation initiation factor 5A-3 OS=Solanum tuberosum GN=EIF5A3 PE=2 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 1.885e-80
Identity = 145/160 (90.62%), Postives = 154/160 (96.25%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPKS 564
            MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFV IDIF+GKKLEDIVPSSHN DVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTDE+LL Q+KDGF EGKDLV++VMS+MGEEQI A+KDIG K+
Sbjct:    1 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTDESLLKQVKDGFQEGKDLVVSVMSAMGEEQINAIKDIGTKN 160          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_SENVE (Eukaryotic translation initiation factor 5A OS=Senecio vernalis GN=EIFSV1 PE=2 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 9.356e-80
Identity = 143/159 (89.94%), Postives = 151/159 (94.97%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPK 561
            MSDEEH FESKADAGASKTYPQQAGTIRK G+IVIK R CKVVEVSTSKTGKHGHAKCHFV IDIF+GKKLEDIVPSSHN DVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDL+LPTD+ LLTQ+KDGF EGKDLV++VMS+MGEEQICALKDIGPK
Sbjct:    1 MSDEEHQFESKADAGASKTYPQQAGTIRKGGHIVIKNRACKVVEVSTSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLKLPTDDALLTQIKDGFGEGKDLVVSVMSAMGEEQICALKDIGPK 159          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A2_SOLLC (Eukaryotic translation initiation factor 5A-2 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 1.222e-79
Identity = 143/160 (89.38%), Postives = 153/160 (95.62%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPKS 564
            MSDEEHHFESKADAGASKT+PQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFV IDIF+GKKLEDIVPSSHN DVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTDE LL Q+KDGF EGKDLV++VMS+MGEEQI A+KD+G K+
Sbjct:    1 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTDENLLKQVKDGFQEGKDLVVSVMSAMGEEQINAVKDVGTKN 160          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A1_MEDSA (Eukaryotic translation initiation factor 5A-1 OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 6.064e-79
Identity = 143/161 (88.82%), Postives = 154/161 (95.65%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDI-VPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPKS 564
            MSDEEH FESKADAGASKTYPQQAGTIRKNGYIVIK RPCKVVEVSTSKTGKHGHAKCHFV IDIF+ KKLE++ VPSSHN DVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDL+LPTD++LLTQ+KDGFAEGKDLV++VMS+MGEEQICALKDIG K+
Sbjct:    1 MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTSKKLEEVYVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLKLPTDDSLLTQIKDGFAEGKDLVVSVMSAMGEEQICALKDIGGKN 161          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_MAIZE (Eukaryotic translation initiation factor 5A OS=Zea mays GN=TIF5A PE=1 SV=2)

HSP 1 Score: 290.812 bits (743), Expect = 3.931e-78
Identity = 139/160 (86.88%), Postives = 151/160 (94.38%), Query Frame = 1
Query:   85 MSD-EEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPK 561
            MSD EEHHFESKADAGASKTYPQQAGT+RKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHFV IDIF+GKKLEDIVPSSHN D+PHVNRT+YQLIDISEDGFVSLLT +GNTKDDLRLPTDETL+ Q+K+GF  GKDLV+TV S+MGEEQICALKD+GPK
Sbjct:    1 MSDSEEHHFESKADAGASKTYPQQAGTVRKNGFIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDIPHVNRTEYQLIDISEDGFVSLLTSDGNTKDDLRLPTDETLVAQIKEGFESGKDLVVTVQSAMGEEQICALKDVGPK 160          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A3_ARATH (Eukaryotic translation initiation factor 5A-3 OS=Arabidopsis thaliana GN=At1g69410 PE=2 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 1.398e-75
Identity = 135/159 (84.91%), Postives = 150/159 (94.34%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPK 561
            MSD+EHHFES +DAGASKTYPQQAG IRK G+IVIKGRPCKVVEVSTSKTGKHGHAKCHFV IDIF+ KKLEDIVPSSHN DVPHVNR DYQLIDISEDGFVSLLT+NG+TKDDL+LPTDE LLTQLK+GF EGKD+V++VMS+MGEEQ+CALK++GPK
Sbjct:    1 MSDDEHHFES-SDAGASKTYPQQAGNIRKGGHIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTSKKLEDIVPSSHNCDVPHVNRVDYQLIDISEDGFVSLLTDNGSTKDDLKLPTDEALLTQLKNGFEEGKDIVVSVMSAMGEEQMCALKEVGPK 158          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A1_ARATH (Eukaryotic translation initiation factor 5A-1 OS=Arabidopsis thaliana GN=At1g13950 PE=2 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 3.114e-75
Identity = 137/159 (86.16%), Postives = 149/159 (93.71%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPK 561
            MSDEEHHFES +DAGASKTYPQQAGTIRKNGYIVIK RPCKVVEVSTSKTGKHGHAKCHFV IDIF+ KKLEDIVPSSHN DVPHVNRTDYQLIDISEDG+VSLLT+NG+TKDDL+LP D+TLL Q+K GF +GKDLV++VMS+MGEEQI ALKDIGPK
Sbjct:    1 MSDEEHHFES-SDAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTSKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGYVSLLTDNGSTKDDLKLPNDDTLLQQIKSGFDDGKDLVVSVMSAMGEEQINALKDIGPK 158          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_DIACA (Eukaryotic translation initiation factor 5A OS=Dianthus caryophyllus PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 2.468e-72
Identity = 126/156 (80.77%), Postives = 145/156 (92.95%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDI 552
            MSD++HHFES ADAGASKTYPQQAGTIRK+G+IVIK RPCKVVEVSTSKTGKHGHAKCHFV IDIF+GKKLEDIVPSSHN DVPHVNR DYQL+DI+EDGFVSLLT++G+TKDDL+LP DE L+ Q+K+GF  GKDL+L+VM +MGEEQICA+KD+
Sbjct:    1 MSDDDHHFESSADAGASKTYPQQAGTIRKSGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVNRVDYQLLDITEDGFVSLLTDSGDTKDDLKLPADEALVKQMKEGFEAGKDLILSVMCAMGEEQICAVKDV 156          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A2_ARATH (Eukaryotic translation initiation factor 5A-2 OS=Arabidopsis thaliana GN=At1g26630 PE=1 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 4.816e-68
Identity = 122/157 (77.71%), Postives = 142/157 (90.45%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIG 555
            MSD+EHHFE+ +++GASKTYPQ AG IRK G+IVIK RPCKVVEVSTSKTGKHGHAKCHFV IDIF+ KKLEDIVPSSHN DVPHVNR DYQLIDI+EDGFVSLLT++G TKDDL+LPTD+ L  Q++ GF EGKD+V++VMSSMGEEQICA+K++G
Sbjct:    1 MSDDEHHFEA-SESGASKTYPQSAGNIRKGGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTAKKLEDIVPSSHNCDVPHVNRVDYQLIDITEDGFVSLLTDSGGTKDDLKLPTDDGLTAQMRLGFDEGKDIVVSVMSSMGEEQICAVKEVG 156          
The following BLAST results are available for this feature:
BLAST of CK740330 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
IF5A3_SOLLC8.462e-8191.82Eukaryotic translation initiation factor 5A-3 OS=S... [more]
IF5A3_SOLTU1.885e-8090.63Eukaryotic translation initiation factor 5A-3 OS=S... [more]
IF5A_SENVE9.356e-8089.94Eukaryotic translation initiation factor 5A OS=Sen... [more]
IF5A2_SOLLC1.222e-7989.38Eukaryotic translation initiation factor 5A-2 OS=S... [more]
IF5A1_MEDSA6.064e-7988.82Eukaryotic translation initiation factor 5A-1 OS=M... [more]
IF5A_MAIZE3.931e-7886.88Eukaryotic translation initiation factor 5A OS=Zea... [more]
IF5A3_ARATH1.398e-7584.91Eukaryotic translation initiation factor 5A-3 OS=A... [more]
IF5A1_ARATH3.114e-7586.16Eukaryotic translation initiation factor 5A-1 OS=A... [more]
IF5A_DIACA2.468e-7280.77Eukaryotic translation initiation factor 5A OS=Dia... [more]
IF5A2_ARATH4.816e-6877.71Eukaryotic translation initiation factor 5A-2 OS=A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_6474 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE63H11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740330 ID=CK740330|Name=CK740330|organism=Citrus sinensis|type=EST|length=637bp
CTCCCTCGCTCGGTCGCCCCCCAGCCTCTCTCAAAATCTCGCTCAGTAAA
TCGGCCGAGTCGGAATCAGTCAGTGCTTAAAACGATGTCGGACGAGGAGC
ATCACTTCGAGTCAAAGGCCGATGCCGGAGCCTCCAAGACTTACCCGCAG
CAAGCTGGTACCATCCGTAAGAATGGCTACATCGTCATCAAAGGCCGTCC
CTGCAAGGTTGTGGAAGTCTCCACCTCCAAGACTGGAAAGCACGGTCATG
CTAAGTGCCACTTTGTTGGAATTGATATCTTCAGTGGAAAGAAGTTGGAA
GATATTGTCCCCTCTTCTCATAACTCTGATGTTCCCCATGTCAACCGTAC
CGACTATCAGTTGATTGATATTTCTGAGGATGGATTTGTGAGTTTGCTGA
CTGAAAATGGGAACACCAAGGATGATCTGAGGCTCCCAACCGATGAGACT
CTGCTGACCCAGCTCAAGGACGGTTTTGCTGAGGGGAAGGACTTGGTTTT
GACTGTCATGTCTTCAATGGGTGAGGAGCAGATCTGTGCCCTCAAGGATA
TTGGCCCAAAGTCGTAGTTGCGCAATATGTGATTATCTGCTATGTCTGGT
TGCATCTGTTTTTTGGAAAATATTTTAATCATCTAGA
back to top